Recombinant Human CD63 Protein (103-203 aa), His-sumostar-tagged

• Cat.No.: CD63-2512H
• Product Overview: Recombinant Human CD63 Protein (103-203 aa) is produced by Yeast expression system. This protein is fused with a 6xHis-sumostar tag at the N-terminal. Protein Description: Partial.

Specification

• Species: Human
• Source: Yeast
• Tag: His&SUMO
• Protein Length: 103-203 aa
• Description: Functions as cell surface receptor for TIMP1 and plays a role in the activation of cellular signaling cascades. Plays a role in the activation of ITGB1 and integrin signaling, leading to the activation of AKT, FAK/PTK2 and MAP kinases. Promotes cell survival, reorganization of the actin cytoskeleton, cell adhesion, spreading and migration, via its role in the activation of AKT and FAK/PTK2. Plays a role in VEGFA signaling via its role in regulating the internalization of KDR/VEGFR2. Plays a role in intracellular vesicular transport processes, and is required for normal trafficking of the PMEL luminal domain that is essential for the development and maturation of melanocytes. Plays a role in the adhesion of leukocytes onto endothelial cells via its role in the regulation of SELP trafficking. May play a role in mast cell degranulation in response to Ms4a2/FceRI stimulation, but not in mast cell degranulation in response to other stimuli.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 27.5 kDa
• AA Sequence: AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: CD63 CD63 molecule [ Homo sapiens ]
• Official Symbol: CD63
• Synonyms: CD63; CD63 molecule; CD63 antigen; ME491; TSPAN30; tspan-30; granulophysin; tetraspanin-30; MLA1; LAMP-3; OMA81H
• Gene ID: 967
• mRNA Refseq: NM_001257389
• Protein Refseq: NP_001244318
• MIM: 155740
• UniProt ID: P08962