Recombinant Human CD63 Full Length Transmembrane protein, His-tagged

Cat.No. : CD63-4837H
Product Overview : Recombinant Human CD63 protein(P08962)(2-238aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 2-238aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 31.5 kDa
AA Sequence : AVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name CD63 CD63 molecule [ Homo sapiens ]
Official Symbol CD63
Synonyms CD63; CD63 molecule; CD63 antigen (melanoma 1 antigen) , MLA1; CD63 antigen; ME491; TSPAN30; tspan-30; granulophysin; tetraspanin-30; melanoma-associated antigen MLA1; CD63 antigen (melanoma 1 antigen); melanoma-associated antigen ME491; ocular melanoma-associated antigen; lysosomal-associated membrane protein 3; lysosome-associated membrane glycoprotein 3; MLA1; LAMP-3; OMA81H;
Gene ID 967
mRNA Refseq NM_001257389
Protein Refseq NP_001244318
MIM 155740
UniProt ID P08962

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CD63 Products

Required fields are marked with *

My Review for All CD63 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon