Recombinant Human CD6 Protein, GST-Tagged

• Cat.No.: CD6-0839H
• Product Overview: Human CD6 partial ORF (NP_006716, 308 a.a. - 400 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a protein found on the outer membrane of T-lymphocytes as well as some other immune cells. The encoded protein contains three scavenger receptor cysteine-rich (SRCR) domains and a binding site for an activated leukocyte cell adhesion molecule. The gene product is important for continuation of T cell activation. This gene may be associated with susceptibility to multiple sclerosis (PMID: 19525953, 21849685). Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 35.97 kDa
• AA Sequence: CGTAVERPKGLPHSLSGRMYYSCNGEELTLSNCSWRFNNSNLCSQSLAARVLCSASRSLHNLSTPEVPASVQTVTIESSVTVKIENKESRELM
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CD6 CD6 molecule [ Homo sapiens ]
• Official Symbol: CD6
• Synonyms: CD6; CD6 molecule; CD6 antigen; T-cell differentiation antigen CD6; Tp120; T12; TP120; FLJ44171
• Gene ID: 923
• mRNA Refseq: NM_001254750
• Protein Refseq: NP_001241679
• MIM: 186720
• UniProt ID: P30203