Recombinant Human CD6 Protein, GST-Tagged

Cat.No. : CD6-0839H
Product Overview : Human CD6 partial ORF (NP_006716, 308 a.a. - 400 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein found on the outer membrane of T-lymphocytes as well as some other immune cells. The encoded protein contains three scavenger receptor cysteine-rich (SRCR) domains and a binding site for an activated leukocyte cell adhesion molecule. The gene product is important for continuation of T cell activation. This gene may be associated with susceptibility to multiple sclerosis (PMID: 19525953, 21849685). Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011]
Molecular Mass : 35.97 kDa
AA Sequence : CGTAVERPKGLPHSLSGRMYYSCNGEELTLSNCSWRFNNSNLCSQSLAARVLCSASRSLHNLSTPEVPASVQTVTIESSVTVKIENKESRELM
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CD6 CD6 molecule [ Homo sapiens ]
Official Symbol CD6
Synonyms CD6; CD6 molecule; CD6 antigen; T-cell differentiation antigen CD6; Tp120; T12; TP120; FLJ44171;
Gene ID 923
mRNA Refseq NM_001254750
Protein Refseq NP_001241679
MIM 186720
UniProt ID P30203

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CD6 Products

Required fields are marked with *

My Review for All CD6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon