Recombinant Full Length Human CD6 Protein

• Cat.No.: CD6-6883HF
• Product Overview: Recombinant full-length Human CD6 was expressed in Wheat Germ.

Specification

• Description: This gene encodes a protein found on the outer membrane of T-lymphocytes as well as some other immune cells. The encoded protein contains three scavenger receptor cysteine-rich (SRCR) domains and a binding site for an activated leukocyte cell adhesion mol
• Source: In Vitro Cell Free System
• Species: Human
• Form: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
• Molecular Mass: 68.9 kDa
• Protein length: 668 amino acids
• AA Sequence: MWLFFGITGLLTAALSGHPSPAPPDQLNTSSAESELWEPGERLPVRLTNGSSSCSGTVEVRLEASWEPACGALWD SRAAEAVCRALGCGGAEAASQLAPPTPELPPPPAAGNTSVAANATLAGAPALLCSGAEWRLCEVVEHACRSDGRR ARVTCAENRALRLVDGGGACAGRVEMLEHGEWGSVCDDTWDLEDAHVVCRQLGCGWAVQALPGLHFTPGRGPIHR DQVNCSGAEAYLWDCPGLPGQHYCGHKEDA
• Applications: Antibody Production.Functional Study: Recommended usage only, not validated yet.Compound Screening: Recommended usage only, not validated yet.
• Notes: Heating may cause protein aggregation. Please do not heat this product before electrophoresis. Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: CD6 CD6 molecule [ Homo sapiens ]
• Official Symbol: CD6
• Synonyms: CD6; CD6 molecule; CD6 antigen; T-cell differentiation antigen CD6; Tp120; T12; TP120; FLJ44171
• Gene ID: 923
• mRNA Refseq: NM_001254750
• Protein Refseq: NP_001241679
• MIM: 186720
• UniProt ID: P30203