Recombinant Human CD6
Cat.No. : | CD6-27581TH |
Product Overview : | Recombinant Human CD6 was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Description : | This gene encodes a protein found on the outer membrane of T-lymphocytes as well as some other immune cells. The encoded protein contains three scavenger receptor cysteine-rich (SRCR) domains and a binding site for an activated leukocyte cell adhesion mol |
Form : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Molecular Mass : | 68.9 kDa |
AA Sequence : | MWLFFGITGLLTAALSGHPSPAPPDQLNTSSAESELWEPGERLPVRLTNGSSSCSGTVEVRLEASWEPACGALWD SRAAEAVCRALGCGGAEAASQLAPPTPELPPPPAAGNTSVAANATLAGAPALLCSGAEWRLCEVVEHACRSDGRR ARVTCAENRALRLVDGGGACAGRVEMLEHGEWGSVCDDTWDLEDAHVVCRQLGCGWAVQALPGLHFTPGRGPIHR DQVNCSGAEAYLWDCPGLPGQHYCGHKEDA |
Applications : | Antibody Production.Functional Study: Recommended usage only, not validated yet.Compound Screening: Recommended usage only, not validated yet. |
Notes : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | CD6 CD6 molecule [ Homo sapiens ] |
Official Symbol | CD6 |
Synonyms | CD6; CD6 molecule; CD6 antigen; T-cell differentiation antigen CD6; Tp120; T12; TP120; FLJ44171; |
Gene ID | 923 |
mRNA Refseq | NM_001254750 |
Protein Refseq | NP_001241679 |
MIM | 186720 |
UniProt ID | P30203 |
Chromosome Location | 11q12.2 |
Pathway | Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; |
Function | scavenger receptor activity; |
◆ Recombinant Proteins | ||
CD6-27581TH | Recombinant Human CD6 | +Inquiry |
CD6-312H | Recombinant Human CD6 protein, His/T7-tagged | +Inquiry |
Cd6-31R | Recombinant Rat Cd6, His tagged | +Inquiry |
Cd6-1710M | Recombinant Mouse CD6 Antigen | +Inquiry |
Cd6-5666R | Recombinant Rat Cd6 protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD6-958RCL | Recombinant Rat CD6 cell lysate | +Inquiry |
CD6-1807MCL | Recombinant Mouse CD6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD6 Products
Required fields are marked with *
My Review for All CD6 Products
Required fields are marked with *
0
Inquiry Basket