Recombinant Human CD55 Protein, His-tagged

• Cat.No.: CD55-164H
• Product Overview: Recombinant human CD55 protein with His tag was expressed in HEK293.

Specification

• Description: This gene encodes a glycoprotein involved in the regulation of the complement cascade. Binding of the encoded protein to complement proteins accelerates their decay, thereby disrupting the cascade and preventing damage to host cells. Antigens present on this protein constitute the Cromer blood group system (CROM). Alternative splicing results in multiple transcript variants. The predominant transcript variant encodes a membrane-bound protein, but alternatively spliced transcripts may produce soluble proteins.
• Source: HEK293
• Species: Human
• Tag: His
• Form: Lyophilized
• Molecular Mass: 35.8 kDa
• Protein length: 381
• AA Sequence: MTVARPSVPAALPLLGELPRLLLLVLLCLPAVWGDCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVPPTVQKPTTVNVPTTEVSPTSQKTTTKTTTPNAQATRSTPVSRTTKHFHETTPNKGSGTTSGTTRLLSGHTCFTLTGLLGTLVTMGLLT
• Purity: > 98%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Concentration: 1 mg/mL
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: CD55 CD55 molecule, decay accelerating factor for complement (Cromer blood group) [ Homo sapiens (human) ]
• Official Symbol: CD55
• Synonyms: CD55; CD55 molecule, decay accelerating factor for complement (Cromer blood group); DAF, decay accelerating factor for complement (CD55, Cromer blood group system); complement decay-accelerating factor; CR; CROM; TC; CD55 antigen; DAF
• Gene ID: 1604
• mRNA Refseq: NM_000574
• Protein Refseq: NP_000565
• MIM: 125240
• UniProt ID: P08174