Recombinant Human CD55 protein(231-350 aa), C-His-tagged

• Cat.No.: CD55-2590H
• Product Overview: Recombinant Human CD55 protein(P08174)(231-350 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 231-350 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: IDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVPPTVQKPTTVNVPTTEVSPTSQKTTTKTTTPNAQATRSTPVSRTTKHFHETTPNKGSG

Gene Information

• Gene Name: CD55 CD55 molecule, decay accelerating factor for complement (Cromer blood group) [ Homo sapiens ]
• Official Symbol: CD55
• Synonyms: CD55; CD55 molecule, decay accelerating factor for complement (Cromer blood group); DAF, decay accelerating factor for complement (CD55, Cromer blood group system); complement decay-accelerating factor; CR; CROM; TC; CD55 antigen; DAF
• Gene ID: 1604
• mRNA Refseq: NM_000574
• Protein Refseq: NP_000565
• MIM: 125240
• UniProt ID: P08174