Recombinant Mouse Cd55 Protein, His-tagged

Cat.No. : Cd55-7191M
Product Overview : Recombinant Mouse Cd55 Protein with a His tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Tag : His
Protein Length : 35-362
Description : This gene encodes an inhibitor of both the classical and the alternative pathways of complement activation. The encoded preproprotein undergoes post-translational processing to generate a mature polypeptide anchored to the plasma membrane via a glycosylphosphatidylinositol moiety. Erythrocytes from mice deficient in the encoded protein exhibit impaired regulation of complement activation resulting in enhanced complement deposition. Mice lacking the encoded protein exhibit enhanced susceptibility to experimentally induced myasthenia gravis. This gene is located adjacent to a closely related gene on chromosome 1.
Form : Liquid
Molecular Mass : 36.8 kDa
AA Sequence : DCGPPPDIPNARPILGRHSKFAEQSKVAYSCNNGFKQVPDKSNIVVCLENGQWSSHETFCEKSCVAPERLSFASLKKEYLNMNFFPVGTIVEYECRPGFRKQPPLPGKATCLEDLVWSPVAQFCKKKSCPNPKDLDNGHINIPTGILFGSEINFSCNPGYRLVGVSSTFCSVTGNTVDWDDEFPVCTEIHCPEPPKINNGIMRGESDSYTYSQVVTYSCDKGFILVGNASIYCTVSKSDVGQWSSPPPRCIEKSKVPTKKPTINVPSTGTPSTPQKPTTESVPNPGDQPTPQKPSTVKVSATQHVPVTKTTVRHPIRTSTDKGEPNTGLEHHHHHH
Endotoxin : < 1.0 EU/μg of protein (determined by LAL method)
Purity : > 95 % by SDS-PAGE
Stability : Shelf life: one year from despatch.
Storage : Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
Concentration : 0.5 mg/mL (determined by absorbance at 280nm)
Storage Buffer : Phosphate Buffered Saline (pH 7.4) containing 10 % glycerol.
Gene Name Cd55 CD55 molecule, decay accelerating factor for complement [ Mus musculus (house mouse) ]
Official Symbol Cd55
Synonyms Cd55; CD55 molecule, decay accelerating factor for complement; Daf; Daf-; Daf1; GPI-; Daf-GPI; GPI-DAF; complement decay-accelerating factor, GPI-anchored; CD55 antigen; Cromer blood group; GPI anchor addition signal; complement-glycosylphosphatidylinositol; decay accelerating factor 1
Gene ID 13136
mRNA Refseq NM_010016
Protein Refseq NP_034146
UniProt ID Q61475

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Cd55 Products

Required fields are marked with *

My Review for All Cd55 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon