Recombinant Human CD5, StrepII-tagged

• Cat.No.: CD5-235H
• Product Overview: Purified human recombinant CD5 or T-cell surface glycoprotein protein (amino acids 25-372, 348 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 38.6 kDa. (Accession NP_055022.2; UniProt P06127)

Specification

• Species: Human
• Source: Human Cells
• Tag: Strep II
• Protein Length: 25-372, 348 a.a.
• Description: This product is the extracellular domain of CD5, a membrane glycoprotein that is thought to act as a receptor in regulating T-cell proliferation.
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
• AA Sequence: RLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTY TPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVV EFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEH CFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSV NSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPNP
• Endotoxin: <0.1 eu per ug protein by lal
• Purity: >95% pure by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.

Gene Information

• Gene Name: CD5 CD5 molecule [ Homo sapiens ]
• Official Symbol: CD5
• Synonyms: CD5; CD5 molecule; CD5 antigen (p56 62) , LEU1; T-cell surface glycoprotein CD5; T1; CD5 antigen (p56-62); lymphocyte antigen T1/Leu-1; LEU1
• Gene ID: 921
• mRNA Refseq: NM_014207
• Protein Refseq: NP_055022
• MIM: 153340
• UniProt ID: P06127
• Chromosome Location: 11q13
• Pathway: B Cell Receptor Signaling Pathway, organism-specific biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; T Cell Receptor Signaling Pathway, organism-specific biosystem
• Function: glycoprotein binding; protein binding; receptor activity; scavenger receptor activity; transmembrane signaling receptor activity