Recombinant Human CD5, StrepII-tagged
Cat.No. : | CD5-235H |
Product Overview : | Purified human recombinant CD5 or T-cell surface glycoprotein protein (amino acids 25-372, 348 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 38.6 kDa. (Accession NP_055022.2; UniProt P06127) |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Strep II |
Protein Length : | 25-372, 348 a.a. |
Description : | This product is the extracellular domain of CD5, a membrane glycoprotein that is thought to act as a receptor in regulating T-cell proliferation. |
Form : | Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free). |
AA Sequence : | RLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTY TPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVV EFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEH CFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSV NSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPNP |
Endotoxin : | <0.1 eu per ug protein by lal |
Purity : | >95% pure by SDS-PAGE |
Storage : | 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles. |
Reconstitution : | Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml. |
Gene Name | CD5 CD5 molecule [ Homo sapiens ] |
Official Symbol | CD5 |
Synonyms | CD5; CD5 molecule; CD5 antigen (p56 62) , LEU1; T-cell surface glycoprotein CD5; T1; CD5 antigen (p56-62); lymphocyte antigen T1/Leu-1; LEU1; |
Gene ID | 921 |
mRNA Refseq | NM_014207 |
Protein Refseq | NP_055022 |
MIM | 153340 |
UniProt ID | P06127 |
Chromosome Location | 11q13 |
Pathway | B Cell Receptor Signaling Pathway, organism-specific biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; T Cell Receptor Signaling Pathway, organism-specific biosystem; |
Function | glycoprotein binding; protein binding; receptor activity; scavenger receptor activity; transmembrane signaling receptor activity; |
◆ Recombinant Proteins | ||
CD5-3098H | Recombinant Human CD5 Protein, MYC/DDK-tagged | +Inquiry |
Cd5-2277M | Recombinant Mouse Cd5 protein, His-tagged | +Inquiry |
CD5-175H | Recombinant Human CD5 protein, His-tagged | +Inquiry |
CD5-5296H | Recombinant Human CD5 Protein (Met1-Pro372), C-His tagged | +Inquiry |
CD5-60HF | Recombinant Full Length Human CD5 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD5-2498MCL | Recombinant Mouse CD5 cell lysate | +Inquiry |
CD5-1293RCL | Recombinant Rat CD5 cell lysate | +Inquiry |
CD5-2572HCL | Recombinant Human CD5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD5 Products
Required fields are marked with *
My Review for All CD5 Products
Required fields are marked with *
0
Inquiry Basket