Recombinant Human CD5 Protein, His-tagged
Cat.No. : | CD5-163H |
Product Overview : | Recombinant human CD5 protein with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 495 |
Description : | This gene encodes a member of the scavenger receptor cysteine-rich (SRCR) superfamily. Members of this family are secreted or membrane-anchored proteins mainly found in cells associated with the immune system. This protein is a type-I transmembrane glycoprotein found on the surface of thymocytes, T lymphocytes and a subset of B lymphocytes. The encoded protein contains three SRCR domains and may act as a receptor to regulate T-cell proliferation. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Form : | Lyophilized |
Molecular Mass : | 40.5 kDa |
AA Sequence : | MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPNPAGLAAGTVASIILALVLLVVLLVVCGPLAYKKLVKKFRQKKQRQWIGPTGMNQNMSFHRNHTATVRSHAENPTASHVDNEYSQPPRNSHLSAYPALEGALHRSSMQPDNSSDSDYDLHGAQRL |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | CD5 CD5 molecule [ Homo sapiens (human) ] |
Official Symbol | CD5 |
Synonyms | CD5; CD5 molecule; CD5 antigen (p56 62) , LEU1; T-cell surface glycoprotein CD5; T1; CD5 antigen (p56-62); lymphocyte antigen T1/Leu-1; LEU1; |
Gene ID | 921 |
mRNA Refseq | NM_014207 |
Protein Refseq | NP_055022 |
MIM | 153340 |
UniProt ID | P06127 |
◆ Recombinant Proteins | ||
Cd5-8796R | Active Recombinant Rat Cd5 protein, His-tagged | +Inquiry |
CD5-697H | Active Recombinant Human CD5 Protein, His-tagged | +Inquiry |
RFL636RF | Recombinant Full Length Rat T-Cell Surface Glycoprotein Cd5(Cd5) Protein, His-Tagged | +Inquiry |
CD5-6713H | Recombinant Human CD5 protein, hFc-Avi-tagged | +Inquiry |
CD5-26633TH | Recombinant Human CD5 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD5-2572HCL | Recombinant Human CD5 cell lysate | +Inquiry |
CD5-1293RCL | Recombinant Rat CD5 cell lysate | +Inquiry |
CD5-2498MCL | Recombinant Mouse CD5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD5 Products
Required fields are marked with *
My Review for All CD5 Products
Required fields are marked with *
0
Inquiry Basket