Recombinant Human CD47 Protein, Fc-tagged
Cat.No. : | CD47-837H |
Product Overview : | Recombinant Human CD47, transcript variant 2, fused with Fc tag at C-terminal was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc |
Description : | This gene encodes a membrane protein, which is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The encoded protein is also a receptor for the C-terminal cell binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This gene has broad tissue distribution, and is reduced in expression on Rh erythrocytes. Alternatively spliced transcript variants have been found for this gene. |
Form : | Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4 |
Molecular Mass : | 40.8kD |
AA Sequence : | QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | CD47 CD47 molecule [ Homo sapiens ] |
Official Symbol | CD47 |
Synonyms | CD47; CD47 molecule; CD47 antigen (Rh related antigen, integrin associated signal transducer) , MER6; leukocyte surface antigen CD47; antigen identified by monoclonal 1D8; antigenic surface determinant protein OA3; CD47 glycoprotein; IAP; integrin associated protein; OA3; Rh related antigen; Rh-related antigen; integrin-associated protein; integrin-associated signal transducer; CD47 antigen (Rh-related antigen, integrin-associated signal transducer); MER6; |
Gene ID | 961 |
mRNA Refseq | NM_001777 |
Protein Refseq | NP_001768 |
MIM | 601028 |
UniProt ID | Q08722 |
◆ Recombinant Proteins | ||
CD47-384M | Recombinant Mouse CD47 protein, Mouse IgG2a Fc-tagged, low endotoxin | +Inquiry |
Cd47-5707M | Recombinant Mouse Cd47 Protein (Met1-Ile162), C-His tagged | +Inquiry |
CD47-7865H | Recombinant Human CD47 protein(Met1-Pro139) | +Inquiry |
RFL27649RF | Recombinant Full Length Rat Leukocyte Surface Antigen Cd47(Cd47) Protein, His-Tagged | +Inquiry |
CD47-3094M | Recombinant Mouse Cd47 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD47-850HCL | Recombinant Human CD47 cell lysate | +Inquiry |
CD47-1363RCL | Recombinant Rat CD47 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD47 Products
Required fields are marked with *
My Review for All CD47 Products
Required fields are marked with *
0
Inquiry Basket