Recombinant Human CD3EAP protein, GST-tagged

• Cat.No.: CD3EAP-8938H
• Product Overview: Recombinant Human CD3EAP(2 a.a. - 110 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 2-110 a.a.
• Description: CD3EAP played an important role in many functions.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 37.73 kDa
• AA Sequence: EEPQAGDAARFSCPPNFTAKPPASESPRFSLEALTGPDTELWLIQAPADFAPECFNGRHVPLSGSQIVKGKLAGK RHRYRVLSSCPQAGEATLLAPSTEAGGGLTCASA
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: CD3EAP CD3e molecule, epsilon associated protein [ Homo sapiens ]
• Official Symbol: CD3EAP
• Synonyms: CD3EAP; CD3e molecule, epsilon associated protein; CD3e antigen, epsilon polypeptide associated protein; DNA-directed RNA polymerase I subunit RPA34; antisense to ERCC 1; ASE 1; CAST; CD3 epsilon associated protein; PAF49; A34.5; CD3E-associated protein; antisense to ERCC-1 protein; CD3-epsilon-associated protein; RNA polymerase I-associated factor PAF49; ASE-1; MGC118851
• Gene ID: 10849
• mRNA Refseq: NM_012099
• Protein Refseq: NP_036231
• MIM: 107325
• UniProt ID: O15446
• Chromosome Location: 19q13.3
• Pathway: TNF-alpha/NF-kB Signaling Pathway, organism-specific biosystem
• Function: DNA-directed RNA polymerase activity