Recombinant Human CD3EAP protein, GST-tagged

Cat.No. : CD3EAP-8938H
Product Overview : Recombinant Human CD3EAP(2 a.a. - 110 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Availability April 20, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 2-110 a.a.
Description : CD3EAP played an important role in many functions.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 37.73 kDa
AA Sequence : EEPQAGDAARFSCPPNFTAKPPASESPRFSLEALTGPDTELWLIQAPADFAPECFNGRHVPLSGSQIVKGKLAGK RHRYRVLSSCPQAGEATLLAPSTEAGGGLTCASA
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name CD3EAP CD3e molecule, epsilon associated protein [ Homo sapiens ]
Official Symbol CD3EAP
Synonyms CD3EAP; CD3e molecule, epsilon associated protein; CD3e antigen, epsilon polypeptide associated protein; DNA-directed RNA polymerase I subunit RPA34; antisense to ERCC 1; ASE 1; CAST; CD3 epsilon associated protein; PAF49; A34.5; CD3E-associated protein; antisense to ERCC-1 protein; CD3-epsilon-associated protein; RNA polymerase I-associated factor PAF49; ASE-1; MGC118851;
Gene ID 10849
mRNA Refseq NM_012099
Protein Refseq NP_036231
MIM 107325
UniProt ID O15446
Chromosome Location 19q13.3
Pathway TNF-alpha/NF-kB Signaling Pathway, organism-specific biosystem;
Function DNA-directed RNA polymerase activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CD3EAP Products

Required fields are marked with *

My Review for All CD3EAP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon