Recombinant Human CD3E Protein, His-tagged

• Cat.No.: CD3E-141H
• Product Overview: Recombinant human CD3E protein with His tag was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 207
• Description: The protein encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women.
• Form: Lyophilized
• Molecular Mass: 13.2 kDa
• AA Sequence: MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
• Purity: > 98%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Concentration: 1 mg/mL
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: CD3E CD3e molecule, epsilon (CD3-TCR complex) [ Homo sapiens (human) ]
• Official Symbol: CD3E
• Synonyms: CD3E; CD3e molecule, epsilon (CD3-TCR complex); CD3e antigen, epsilon polypeptide (TiT3 complex); T-cell surface glycoprotein CD3 epsilon chain; CD3-epsilon; T-cell surface antigen T3/Leu-4 epsilon chain; T-cell antigen receptor complex, epsilon subunit of T3; T3E; TCRE; FLJ18683
• Gene ID: 916
• mRNA Refseq: NM_000733
• Protein Refseq: NP_000724
• MIM: 186830
• UniProt ID: P07766