Recombinant Human CD3E Protein, His-tagged
Cat.No. : | CD3E-141H |
Product Overview : | Recombinant human CD3E protein with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 207 |
Description : | The protein encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women. |
Form : | Lyophilized |
Molecular Mass : | 13.2 kDa |
AA Sequence : | MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | CD3E CD3e molecule, epsilon (CD3-TCR complex) [ Homo sapiens (human) ] |
Official Symbol | CD3E |
Synonyms | CD3E; CD3e molecule, epsilon (CD3-TCR complex); CD3e antigen, epsilon polypeptide (TiT3 complex); T-cell surface glycoprotein CD3 epsilon chain; CD3-epsilon; T-cell surface antigen T3/Leu-4 epsilon chain; T-cell antigen receptor complex, epsilon subunit of T3; T3E; TCRE; FLJ18683; |
Gene ID | 916 |
mRNA Refseq | NM_000733 |
Protein Refseq | NP_000724 |
MIM | 186830 |
UniProt ID | P07766 |
◆ Recombinant Proteins | ||
CD3E-047H | Recombinant Human CD3E Protein, Asp23-Thr48, C-hFc-Avi tagged, Biotinylated | +Inquiry |
CD3E-138H | Recombinant Human CD3E Protein, His-tagged, Biotinylated | +Inquiry |
CD3E-140C | Recombinant Cynomolgus monkey CD3E Protein, His and Fc-tagged | +Inquiry |
CD3E&CD3G-222C | Recombinant Cynomolgus CD3E & CD3G protein, Fc-tagged | +Inquiry |
CD3E-5633C | Recombinant Cynomolgus CD3E protein, hFc-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD3E-1275HCL | Recombinant Human CD3E cell lysate | +Inquiry |
CD3E-1602CCL | Recombinant Cynomolgus CD3E cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD3E Products
Required fields are marked with *
My Review for All CD3E Products
Required fields are marked with *
0
Inquiry Basket