Recombinant Mouse CD3E Protein, Fc-tagged
Cat.No. : | CD3E-144M |
Product Overview : | Recombinant Mouse CD3E protein with Fc tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | HEK293 |
Tag : | Fc |
Protein Length : | 189 |
Description : | Predicted to enable several functions, including SH3 domain binding activity; identical protein binding activity; and protein heterodimerization activity. Involved in nervous system development and positive regulation of cell adhesion. Acts upstream of or within several processes, including positive regulation of T cell activation; positive regulation of cytokine production; and regulation of signal transduction. Located in several cellular components, including dendritic spine; external side of plasma membrane; and immunological synapse. Part of alpha-beta T cell receptor complex. Is expressed in colon and hemolymphoid system. Human ortholog(s) of this gene implicated in immunodeficiency 18. Orthologous to human CD3E (CD3e molecule). |
Form : | Lyophilized |
Molecular Mass : | 36 kDa |
AA Sequence : | MRWNTFWGILCLSLLAVGTCQDDAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVDLTAVAIIIIVDICITLGLLMVIYYWSKNRKAKAKPVTRGTGAGSRPRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRAV |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | Cd3e CD3 antigen, epsilon polypeptide [ Mus musculus (house mouse) ] |
Official Symbol | CD3E |
Synonyms | CD3E; CD3 antigen, epsilon polypeptide; T-cell surface glycoprotein CD3 epsilon chain; T-cell surface antigen T3/Leu-4 epsilon chain; CD3; T3e; AI504783; CD3epsilon; |
Gene ID | 12501 |
mRNA Refseq | NM_007648 |
Protein Refseq | NP_031674 |
UniProt ID | P22646 |
◆ Recombinant Proteins | ||
CD3E & CD3G-1961M | Recombinant Mouse CD3E & CD3G protein, hFc-tagged | +Inquiry |
CD3E-675H | Recombinant Human CD3E protein, hFc-tagged | +Inquiry |
CD3E-2194H | Recombinant Human CD3E, His tagged | +Inquiry |
CD3E-3082H | Active Recombinant Human CD3E protein, mFc-tagged | +Inquiry |
CD3E-199C | Recombinant Cynomolgus CD3E protein, His/Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD3E-1602CCL | Recombinant Cynomolgus CD3E cell lysate | +Inquiry |
CD3E-1275HCL | Recombinant Human CD3E cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD3E Products
Required fields are marked with *
My Review for All CD3E Products
Required fields are marked with *
0
Inquiry Basket