Recombinant Mouse CD3E Protein, Fc-tagged

• Cat.No.: CD3E-144M
• Product Overview: Recombinant Mouse CD3E protein with Fc tag was expressed in HEK293.

Specification

• Species: Mouse
• Source: HEK293
• Tag: Fc
• Protein Length: 189
• Description: Predicted to enable several functions, including SH3 domain binding activity; identical protein binding activity; and protein heterodimerization activity. Involved in nervous system development and positive regulation of cell adhesion. Acts upstream of or within several processes, including positive regulation of T cell activation; positive regulation of cytokine production; and regulation of signal transduction. Located in several cellular components, including dendritic spine; external side of plasma membrane; and immunological synapse. Part of alpha-beta T cell receptor complex. Is expressed in colon and hemolymphoid system. Human ortholog(s) of this gene implicated in immunodeficiency 18. Orthologous to human CD3E (CD3e molecule).
• Form: Lyophilized
• Molecular Mass: 36 kDa
• AA Sequence: MRWNTFWGILCLSLLAVGTCQDDAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVDLTAVAIIIIVDICITLGLLMVIYYWSKNRKAKAKPVTRGTGAGSRPRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRAV
• Purity: > 98%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Concentration: 1 mg/mL
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: Cd3e CD3 antigen, epsilon polypeptide [ Mus musculus (house mouse) ]
• Official Symbol: CD3E
• Synonyms: CD3E; CD3 antigen, epsilon polypeptide; T-cell surface glycoprotein CD3 epsilon chain; T-cell surface antigen T3/Leu-4 epsilon chain; CD3; T3e; AI504783; CD3epsilon
• Gene ID: 12501
• mRNA Refseq: NM_007648
• Protein Refseq: NP_031674
• UniProt ID: P22646