Recombinant Human CD3D Protein
Cat.No. : | CD3D-0799H |
Product Overview : | Human CD3D full-length ORF (NP_000723.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Description : | The protein encoded by this gene is part of the T-cell receptor/CD3 complex (TCR/CD3 complex) and is involved in T-cell development and signal transduction. The encoded membrane protein represents the delta subunit of the CD3 complex, and along with four other CD3 subunits, binds either TCR alpha/beta or TCR gamma/delta to form the TCR/CD3 complex on the surface of T-cells. Defects in this gene are a cause of severe combined immunodeficiency autosomal recessive T-cell-negative/B-cell-positive/NK-cell-positive (SCIDBNK). Two transcript variants encoding different isoforms have been found for this gene. Other variants may also exist, but the full-length natures of their transcripts has yet to be defined. [provided by RefSeq, Feb 2009] |
Form : | Liquid |
Molecular Mass : | 18.9 kDa |
AA Sequence : | MEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNK |
Applications : | Antibody Production Functional Study Compound Screening |
Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene Name | CD3D CD3d molecule, delta (CD3-TCR complex) [ Homo sapiens ] |
Official Symbol | CD3D |
Synonyms | CD3D; CD3d molecule, delta (CD3-TCR complex); CD3d antigen, delta polypeptide (TiT3 complex), T3D; T-cell surface glycoprotein CD3 delta chain; CD3 delta; OKT3, delta chain; CD3 antigen, delta subunit; T-cell receptor T3 delta chain; CD3d antigen, delta polypeptide (TiT3 complex); T3D; CD3-DELTA; |
Gene ID | 915 |
mRNA Refseq | NM_000732 |
Protein Refseq | NP_000723 |
MIM | 186790 |
UniProt ID | P04234 |
◆ Recombinant Proteins | ||
CD3D-0799H | Recombinant Human CD3D Protein | +Inquiry |
CD3D-163H | Rcombinant Human CD3D, flag-tagged | +Inquiry |
RFL12764HF | Recombinant Full Length Human T-Cell Surface Glycoprotein Cd3 Delta Chain(Cd3D) Protein, His-Tagged | +Inquiry |
CD3D-28H | Active Recombinant Human CD3D Protein (Phe22-Ala105), C-Fc-tagged | +Inquiry |
CD3D-672C | Recombinant Chicken CD3D Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD3D-1466CCL | Recombinant Cynomolgus CD3D cell lysate | +Inquiry |
CD3D-1274HCL | Recombinant Human CD3D cell lysate | +Inquiry |
CD3D-1381MCL | Recombinant Mouse CD3D cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD3D Products
Required fields are marked with *
My Review for All CD3D Products
Required fields are marked with *
0
Inquiry Basket