Recombinant Human CD34 protein(81-220 aa), C-His-tagged
Cat.No. : | CD34-2710H |
Product Overview : | Recombinant Human CD34 protein(P28906)(81-220 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 81-220 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | EATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQA |
Gene Name | CD34 CD34 molecule [ Homo sapiens ] |
Official Symbol | CD34 |
Synonyms | CD34; CD34 molecule; CD34 antigen; hematopoietic progenitor cell antigen CD34; |
Gene ID | 947 |
mRNA Refseq | NM_001025109 |
Protein Refseq | NP_001020280 |
MIM | 142230 |
UniProt ID | P28906 |
◆ Recombinant Proteins | ||
CD34-152H | Recombinant Human CD34 Protein, DYKDDDDK-tagged | +Inquiry |
CD34-192H | Recombinant Human CD34 Protein, C-His-tagged | +Inquiry |
CD34-3099H | Recombinant Human CD34 Protein, MYC/DDK-tagged | +Inquiry |
CD34-5345H | Recombinant Human CD34 Protein (Met1-Thr290), C-His tagged | +Inquiry |
CD34-2710H | Recombinant Human CD34 protein(81-220 aa), C-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD34-1408RCL | Recombinant Rat CD34 cell lysate | +Inquiry |
CD34-3047HCL | Recombinant Human CD34 cell lysate | +Inquiry |
CD34-2232MCL | Recombinant Mouse CD34 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD34 Products
Required fields are marked with *
My Review for All CD34 Products
Required fields are marked with *
0
Inquiry Basket