Recombinant Human CD34 protein(81-220 aa), C-His-tagged

• Cat.No.: CD34-2710H
• Product Overview: Recombinant Human CD34 protein(P28906)(81-220 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 81-220 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: EATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQA
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: CD34 CD34 molecule [ Homo sapiens ]
• Official Symbol: CD34
• Synonyms: CD34; CD34 molecule; CD34 antigen; hematopoietic progenitor cell antigen CD34
• Gene ID: 947
• mRNA Refseq: NM_001025109
• Protein Refseq: NP_001020280
• MIM: 142230
• UniProt ID: P28906