Recombinant Full Length Human CD320 Protein

• Cat.No.: CD320-3159HF
• Product Overview: Human CD320 full-length ORF (NP_057663.1) recombinant protein without tag.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Protein Length: 280 amino acids
• Description: This gene encodes the transcobalamin receptor that is expressed at the cell surface. It mediates the cellular uptake of transcobalamin bound cobalamin (vitamin B12), and is involved in B-cell proliferation and immunoglobulin secretion. Mutations in this gene are associated with methylmalonic aciduria. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jan 2011]
• Form: Liquid
• Molecular Mass: 29 kDa
• AA Sequence: MSGGWMAQVGAWRTGALGLALLLLLGLGLGLEAAASPLSTPTSAQAAGPSSGSCPPTKFQCRTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAYGVIAAAAVLSASLVTATLLLLSWLRAQERLRPLGLLVAMKESLLLSEQKTSLP
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.

Gene Information

• Gene Name: CD320 CD320 molecule [ Homo sapiens (human) ]
• Official Symbol: CD320
• Synonyms: CD320; CD320 molecule; 8D6; 8D6A; TCBLR; CD320 antigen; 8D6 antigen; FDC-SM-8D6; FDC-signaling molecule 8D6; transcobalamin receptor; CD320 Antigen; 8D6 Antigen; FDC-Signaling Molecule 8D6; Transcobalamin Receptor; FDC-SM-8D6
• Gene ID: 51293
• mRNA Refseq: NM_001165895
• Protein Refseq: NP_001159367
• MIM: 606475
• UniProt ID: Q9NPF0