Recombinant Human CD300LB Protein (18-151 aa), His-tagged

• Cat.No.: CD300LB-1355H
• Product Overview: Recombinant Human CD300LB Protein (18-151 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Description: Acts as an activating immune receptor through its interaction with ITAM-bearing adapter TYROBP, and also independently by recruitment of GRB2.
• Source: Yeast
• Species: Human
• Tag: His
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 17.2 kDa
• Protein length: 18-151 aa
• AA Sequence: IQGPESVRAPEQGSLTVQCHYKQGWETYIKWWCRGVRWDTCKILIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDADVYWCGIERRGPDLGTQVKVIVDPEGAASTTASSPTNSNMAVFIGSHKRNHY
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: CD300LB CD300 molecule-like family member b [ Homo sapiens ]
• Official Symbol: CD300LB
• Synonyms: CD300B; CLM 7; CLM7; CLM7_HUMAN; CMRF35 A2; IREM 3; IREM3; LMIR5; TREM 5; TREM5
• Gene ID: 124599
• mRNA Refseq: NM_174892.2
• Protein Refseq: NP_777552.2
• MIM: 610705
• UniProt ID: A8K4G0