Recombinant Human CD300LB Protein (18-151 aa), His-tagged
Cat.No. : | CD300LB-1355H |
Product Overview : | Recombinant Human CD300LB Protein (18-151 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 18-151 aa |
Description : | Acts as an activating immune receptor through its interaction with ITAM-bearing adapter TYROBP, and also independently by recruitment of GRB2. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 17.2 kDa |
AA Sequence : | IQGPESVRAPEQGSLTVQCHYKQGWETYIKWWCRGVRWDTCKILIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDADVYWCGIERRGPDLGTQVKVIVDPEGAASTTASSPTNSNMAVFIGSHKRNHY |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Gene Name | CD300LB CD300 molecule-like family member b [ Homo sapiens ] |
Official Symbol | CD300LB |
Synonyms | CD300B; CLM 7; CLM7; CLM7_HUMAN; CMRF35 A2; IREM 3; IREM3; LMIR5; TREM 5; TREM5; |
Gene ID | 124599 |
mRNA Refseq | NM_174892.2 |
Protein Refseq | NP_777552.2 |
MIM | 610705 |
UniProt ID | A8K4G0 |
◆ Recombinant Proteins | ||
CD300LB-1355H | Recombinant Human CD300LB Protein (18-151 aa), His-tagged | +Inquiry |
CD300LB-565H | Recombinant Human CD300LB(Ile55-His187) Protein, C-Fc-tagged | +Inquiry |
CD300LB-2661H | Recombinant Human CD300LB protein, His-tagged | +Inquiry |
CD300LB-017H | Recombinant Human CD300LB Protein, His-tagged | +Inquiry |
CD300LB-10941H | Recombinant Human CD300LB, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD300LB-176HCL | Recombinant Human CD300LB lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD300LB Products
Required fields are marked with *
My Review for All CD300LB Products
Required fields are marked with *
0
Inquiry Basket