Recombinant Human CD300E, His-tagged

Cat.No. : CD300E-58H
Product Overview : Recombinant Human CD300E is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Leu18-Leu169) of Human CD300E fused with a polyhistidine tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 18-169 a.a.
Description : CD300E is a single-pass type I membrane protein that belongs to the CD300 family. CD300E has a single extracellular V-type Ig-like domain and presents on the surface of mature hematopoietic cells of the monocyte and myeloid lineages. CD300E acts as an activating receptor of the immunoglobulin (Ig) superfamily. It also mediates activating signals by interacting with DAP12.
Form : Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.2
AA Sequence : LKGPGSVTGTAGDSLTVWCQYESMYKGYNKYWCRGQYDTSCESIVETKGEEKVERNGRVSIRDHP EALAFTVTMQNLNEDDAGSYWCKIQTVWVLDSWSRDPSDLVRVYVSPAITTPRRTTHPATPPIFL VVNPGRNLSTREVLTQNSGFRLVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name CD300E CD300e molecule [ Homo sapiens ]
Official Symbol CD300E
Synonyms CD300E; CD300e molecule; CD300 antigen like family member E , CD300e antigen , CD300LE; CMRF35-like molecule 2; CLM2; IREM2; CD300e antigen; poly-Ig receptor 2; CD300 antigen like family member E; CD300 antigen-like family member E; polymeric immunoglobulin receptor 2; immune receptor expressed on myeloid cells 2; CLM-2; PIgR2; IREM-2; PIgR-2; CD300LE; CMRF35-A5;
Gene ID 342510
mRNA Refseq NM_181449
Protein Refseq NP_852114
MIM 609801
UniProt ID Q496F6
Chromosome Location 17q25.1
Function receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CD300E Products

Required fields are marked with *

My Review for All CD300E Products

Required fields are marked with *

0

Inquiry Basket

cartIcon