Recombinant Human CD276 Protein, His-Flag-StrepII-Tagged
Cat.No. : | CD276-0766H |
Product Overview : | Purified CD276 (AAH62581.1 28 a.a. - 238 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Flag&His&Strep II |
Protein Length : | 28-238 a.a. |
Description : | The protein encoded by this gene belongs to the immunoglobulin superfamily, and thought to participate in the regulation of T-cell-mediated immune response. Studies show that while the transcript of this gene is ubiquitously expressed in normal tissues and solid tumors, the protein is preferentially expressed only in tumor tissues. Additionally, it was observed that the 3' UTR of this transcript contains a target site for miR29 microRNA, and there is an inverse correlation between the expression of this protein and miR29 levels, suggesting regulation of expression of this gene product by miR29. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011] |
Form : | Liquid |
Bio-activity : | Not Tested |
Molecular Mass : | 28.49 kDa |
AA Sequence : | ALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTIT |
Applications : | Western Blot Enzyme-linked Immunoabsorbent Assay SDS-PAGE Protein Interaction |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Concentration : | ≥ 10 μg/mL |
Storage Buffer : | 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin. |
Gene Name | CD276 CD276 molecule [ Homo sapiens ] |
Official Symbol | CD276 |
Synonyms | CD276; CD276 molecule; CD276 antigen; B7 H3; B7H3; B7RP 2; B7 homolog 3; costimulatory molecule; B7-H3; B7RP-2; 4Ig-B7-H3; |
Gene ID | 80381 |
mRNA Refseq | NM_001024736 |
Protein Refseq | NP_001019907 |
MIM | 605715 |
UniProt ID | Q5ZPR3 |
◆ Recombinant Proteins | ||
CD276-941M | Recombinant Mouse CD276 protein, His-tagged | +Inquiry |
Cd276-40RA | Recombinant Rat Cd276 protein, Fc-tagged, APC labeled | +Inquiry |
CD276-183H | Recombinant Human CD276, Fc-tagged | +Inquiry |
Cd276-1140M | Recombinant Mouse Cd276 protein(Met1-Phe244), His-tagged, Biotinylated | +Inquiry |
CD276-1243R | Recombinant Rat CD276 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD276-001MCL | Recombinant Mouse CD276 cell lysate | +Inquiry |
CD276-826RCL | Recombinant Rat CD276 cell lysate | +Inquiry |
CD276-1959HCL | Recombinant Human CD276 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD276 Products
Required fields are marked with *
My Review for All CD276 Products
Required fields are marked with *
0
Inquiry Basket