Recombinant Human CD274 Protein, His-tagged

• Cat.No.: CD274-054H
• Product Overview: Recombinant Human CD274 Protein with His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: Programmed cell death 1 ligand 1 (PD-L1, B7-H1, CD274) is a member of the B7 family of cell surface ligands that regulate T cell activation and immune responses. The PD-L1 ligand binds the PD-1 transmembrane receptor and inhibits T cell activation. PD-L1 was discovered following a search for novel B7 protein homologs and was later shown to be expressed by antigen presenting cells, activated T cells, and tissues including placenta, heart, and lung. Similar in structure to related B7 family members, PD-L1 protein contains extracellular IgV and IgC domains and a short, cytoplasmic region. Research studies demonstrate that PD-L1 is expressed in several tumor types, including melanoma, ovary, colon, lung, breast, and renal cell carcinomas. Expression of PD-L1 in cancer is associated with tumor-infiltrating lymphocytes, which mediate PD-L1 expression through the release of interferon gamma. Additional research links PD-L1 expression to cancers associated with viral infections.
• Molecular Mass: ~30 kDa
• AA Sequence: FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
• Notes: For research use only, not for use in diagnostic procedure.
• Storage: Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
• Storage Buffer: PBS, 4M Urea, pH7.4

Gene Information

• Gene Name: CD274 CD274 molecule [ Homo sapiens (human) ]
• Official Symbol: CD274
• Synonyms: CD274; CD274 molecule; CD274 antigen , PDCD1LG1, programmed cell death 1 ligand 1; programmed cell death 1 ligand 1; B7 homolog 1; B7 H; B7 H1; B7H1; PD L1; PDL1; CD274 antigen; PDCD1 ligand 1; programmed death ligand 1; B7-H; PD-L1; PDCD1L1; PDCD1LG1; MGC142294; MGC142296
• Gene ID: 29126
• mRNA Refseq: NM_014143
• Protein Refseq: NP_054862
• MIM: 605402
• UniProt ID: Q9NZQ7