Recombinant Human CD274 Protein, His&T7-tagged

• Cat.No.: CD274-6778H
• Product Overview: Recombinant Human CD274 Protein extracellular domain (BC074984, 19-238aa), was expressed in E. coli as inclusion bodies with N-terminal small T7-His-TEV cleavage site Tag (29aa) (final product refolded and chromatographically purified; codon-optimized cDNA).

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• Protein Length: 19-238 aa
• Form: Liquid
• AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER
• Purity: > 90% by SDS-PAGE
• Usage: Standard coating was performed using 1ml PBS / well, which contains 5-10 ug protein / well) for incubating at 4°C overnight. After coating, remove PBS solution, the plate is ready for cell culture study.
• Storage: Keep at -20 centigrade for long term storage. Product is stableat 4 centigrade for at least 30 days.
• Concentration: 0.5 mg/mL
• Storage Buffer: 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.

Gene Information

• Gene Name: CD274 CD274 molecule [ Homo sapiens (human) ]
• Official Symbol: CD274
• Synonyms: CD274; CD274 molecule; B7-H; B7H1; PDL1; PD-L1; hPD-L1; PDCD1L1; PDCD1LG1; programmed cell death 1 ligand 1; B7 homolog 1; CD274 antigen; PDCD1 ligand 1
• Gene ID: 29126
• mRNA Refseq: NM_014143
• Protein Refseq: NP_054862
• MIM: 605402
• UniProt ID: Q9NZQ7