Recombinant Human CD247 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CD247-2726H
• Product Overview: CD247 MS Standard C13 and N15-labeled recombinant protein (NP_000725) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene is T-cell receptor zeta, which together with T-cell receptor alpha/beta and gamma/delta heterodimers, and with CD3-gamma, -delta and -epsilon, forms the T-cell receptor-CD3 complex. The zeta chain plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Low expression of the antigen results in impaired immune response. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
• Molecular Mass: 18.7 kDa
• AA Sequence: MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CD247 CD247 molecule [ Homo sapiens (human) ]
• Official Symbol: CD247
• Synonyms: CD247; CD247 molecule; CD3Z, CD3z antigen, zeta polypeptide (TiT3 complex), CD247 antigen; T-cell surface glycoprotein CD3 zeta chain; CD3H; CD3Q; CD3zeta chain; TCR zeta chain; CD247 antigen, zeta subunit; T-cell receptor T3 zeta chain; CD3Z antigen, zeta polypeptide (TiT3 complex); T-cell antigen receptor complex, zeta subunit of CD3; T3Z; CD3Z; TCRZ; CD3-ZETA
• Gene ID: 919
• mRNA Refseq: NM_000734
• Protein Refseq: NP_000725
• MIM: 186780
• UniProt ID: P20963