Recombinant Human CD244 protein, hFc-Myc-tagged

• Cat.No.: CD244-6754H
• Product Overview: Recombinant Human CD244 protein(Q9BZW8)(22-221aa), fused with C-terminal hFc and Myc tag, was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: C-hFc-Myc
• ProteinLength: 22-221aa
• Tag: C-hFc-Myc
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 51.0 kDa
• AASequence: CQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWENGSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATFQVFVFESLLPDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSKLIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNA
• Purity: Greater than 90% as determined by SDS-PAGE.
  Greater than 90% as determined by SEC-HPLC.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: CD244 CD244 molecule, natural killer cell receptor 2B4 [ Homo sapiens ]
• Official Symbol: CD244
• Synonyms: CD244; CD244 molecule, natural killer cell receptor 2B4; CD244 natural killer cell receptor 2B4 , natural killer cell receptor 2B4; natural killer cell receptor 2B4; 2B4; NAIL; NKR2B4; Nmrk; SLAMF4; h2B4; NK cell activation-inducing ligand; NK cell type I receptor protein 2B4; NK cell activation inducing ligand NAIL
• Gene ID: 51744
• mRNA Refseq: NM_001166663
• Protein Refseq: NP_001160135
• MIM: 605554
• UniProt ID: Q9BZW8