Active Recombinant Human CD244, His-tagged, Biotinylated

• Cat.No.: CD244-683H
• Product Overview: The recombinant human SLAMF4 ECD protein is expressed as a 214-amino acid protein consisting of Cys22 - Pro224 region of SLAMF4 (UniProt accession #Q9BZW8 - isoform 2) and a C-terminal His-tag. It contains 8 potential sites for N-linked glycosylation.

Specification

• Species: Human
• Source: Human Cells
• Tag: His
• Protein Length: 22-224 a.a.
• Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
• Bio-activity: Immobilized SLAMF4 binds heterophilically to SLAMF2/CD48 in a functional ELISA
• Molecular Mass: Calculated molecular mass (kDa): 24.0; Estimated by SDS-PAGE under reducing condition (kDa): 40-50
• AA Sequence: CQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWENGSLPSNTSNDRFSFIVKNLSLLIK AAQQQDSGLYCLEVTSISGKVQTATFQVFVFDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSK LIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNAHQEFRFWPSTGHHHHHHHH
• Endotoxin: <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">
• Purity: >90% judged by SDS-PAGE under reducing condition
• Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.

Gene Information

• Gene Name: CD244 CD244 molecule, natural killer cell receptor 2B4 [ Homo sapiens ]
• Official Symbol: CD244
• Synonyms: CD244; CD244 molecule, natural killer cell receptor 2B4; CD244 natural killer cell receptor 2B4 , natural killer cell receptor 2B4; natural killer cell receptor 2B4; 2B4; NAIL; NKR2B4; Nmrk; SLAMF4; h2B4; NK cell activation-inducing ligand; NK cell type I receptor protein 2B4; NK cell activation inducing ligand NAIL
• Gene ID: 51744
• mRNA Refseq: NM_001166663
• Protein Refseq: NP_001160135
• MIM: 605554
• UniProt ID: Q9BZW8
• Chromosome Location: 1q23.1
• Pathway: Cell surface interactions at the vascular wall, organism-specific biosystem; Hemostasis, organism-specific biosystem; Natural killer cell mediated cytotoxicity, organism-specific biosystem; Natural killer cell mediated cytotoxicity, conserved biosystem
• Function: protein binding; receptor activity