Recombinant Human CD226 protein, T7/His-tagged

• Cat.No.: CD226-139H
• Product Overview: Recombinant human CD226 extracellular domain cDNA (19 - 254 aa, derived from BC074787) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• Protein Length: 19-254 a.a.
• Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
• AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEEEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSP THGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHI VSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVS DSGLYRCYLQASAGENETFVMRLTVAEGKTDNQYTLFVA
• Purity: >90% by SDS-PAGE
• Applications: 1. May be used as coating matrix protein or as soluble receptor for in vitro lymphocytes differentiation or activation regulations study.2. May be used for protein-protein interaction assay development.3. As antigen for specific antibody production.
• Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.

Gene Information

• Gene Name: CD226 CD226 molecule [ Homo sapiens ]
• Official Symbol: CD226
• Synonyms: CD226; CD226 molecule; CD226 antigen; DNAM 1; DNAM1; PTA1; TLiSA1; adhesion glycoprotein; DNAX accessory molecule 1; DNAX accessory molecule-1; platelet and T cell activation antigen 1; T lineage-specific activation antigen 1 antigen; DNAM-1
• Gene ID: 10666
• mRNA Refseq: NM_006566
• Protein Refseq: NP_006557
• MIM: 605397
• UniProt ID: Q15762
• Chromosome Location: 18q22.3
• Pathway: Adaptive Immune System, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Immune System, organism-specific biosystem; Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell, organism-specific biosystem
• Function: cell adhesion molecule binding; integrin binding; protein binding; protein kinase binding; receptor activity