Recombinant Human CD226 Protein, GST-Tagged
Cat.No. : | CD226-0750H |
Product Overview : | Human CD226 partial ORF (NP_006557, 21 a.a. - 127 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a glycoprotein expressed on the surface of NK cells, platelets, monocytes and a subset of T cells. It is a member of the Ig-superfamily containing 2 Ig-like domains of the V-set. The protein mediates cellular adhesion of platelets and megakaryocytic cells to vascular endothelial cells. The protein also plays a role in megakaryocytic cell maturation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2015] |
Molecular Mass : | 37.51 kDa |
AA Sequence : | VLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CD226 CD226 molecule [ Homo sapiens ] |
Official Symbol | CD226 |
Synonyms | CD226; CD226 molecule; CD226 antigen; DNAM 1; DNAM1; PTA1; TLiSA1; adhesion glycoprotein; DNAX accessory molecule 1; DNAX accessory molecule-1; platelet and T cell activation antigen 1; T lineage-specific activation antigen 1 antigen; DNAM-1; |
Gene ID | 10666 |
mRNA Refseq | NM_006566 |
Protein Refseq | NP_006557 |
MIM | 605397 |
UniProt ID | Q15762 |
◆ Recombinant Proteins | ||
CD226-7254H | Recombinant Human CD226, His-tagged | +Inquiry |
Cd226-1105RAF647 | Recombinant Rat Cd226 Protein, His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
Cd226-8794RAF647 | Recombinant Rat Cd226 Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
CD226-634HA | Recombinant Human CD226 protein, Fc-His-tagged, APC labeled | +Inquiry |
CD226-634HF | Recombinant Human CD226 Protein, Fc/His-tagged, FITC conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD226-2645HCL | Recombinant Human CD226 cell lysate | +Inquiry |
CD226-2800MCL | Recombinant Mouse CD226 cell lysate | +Inquiry |
CD226-1167CCL | Recombinant Cynomolgus CD226 cell lysate | +Inquiry |
CD226-1173RCL | Recombinant Rat CD226 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD226 Products
Required fields are marked with *
My Review for All CD226 Products
Required fields are marked with *
0
Inquiry Basket