Recombinant Human CD22 Protein, C-His-tagged
Cat.No. : | CD22-181H |
Product Overview : | Recombinant Human CD22 Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | CD22 (also known as siglec-2) is a member of the sialic acid-binding immunoglobulin-type lectin (Siglec) family of immunomodulatory receptors. CD22 can bind to its ligand α 2,6-linked sialic acid on different cells (trans interaction) as well as on the same cells (cis interaction). CD22 is predominantly expressed on B cells and functions as an inhibitory co-receptor for the B cell receptor (BCR). After BCR ligation, the tyrosine kinase Lyn is activated and phosphorylates two distal of the four ITIM motifs in the intracellular carboxy-terminal region of CD22, which then recruit tyrosine phosphatases, including SHP-1, to the plasma membrane, and in turn, they get tyrosine-phosphorylated and activated to damp the signaling pathways initiated by BCR ligation. CD22 has been actively pursued as a therapeutic target for autoimmune diseases. Due to almost exclusive expression on B cells, it is also actively pursued as a therapeutic target for multiple B cell malignancies. |
Molecular Mass : | ~74 kDa |
AA Sequence : | DSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFHNPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHLNDSGQLGLRMESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCYGYPIQLQWLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKHTPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLKKQNTFTLNLREVTKDQSGKYCCQVSNDVGPGRSEEVFLQVQYAPEPSTVQILHSPAVEGSQVEFLCMSLANPLPTNYTWYHNGKEMQGRTEEKVHIPKILPWHAGTYSCVAENILGTGQRGPGAELDVQYPPKKVTTVIQNPMPIREGDTVTLSCNYNSSNPSVTRYEWKPHGAWEEPSLGVLKIQNVGWDNTTIACAACNSWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKEVQFFWEKNGRLLGKESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSMSPGDQVMEGKSATLTCESDANPPVSHYTWFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQGTNSVGKGRSPLSTLTVYYSPETIGRR |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | CD22 CD22 molecule [ Homo sapiens (human) ] |
Official Symbol | CD22 |
Synonyms | CD22; CD22 molecule; CD22 antigen; B-cell receptor CD22; sialic acid binding Ig like lectin 2; SIGLEC 2; SIGLEC2; BL-CAM; T-cell surface antigen Leu-14; B-lymphocyte cell adhesion molecule; sialic acid binding Ig-like lectin 2; sialic acid-binding Ig-like lectin 2; SIGLEC-2; FLJ22814; MGC130020; |
Gene ID | 933 |
mRNA Refseq | NM_001185099 |
Protein Refseq | NP_001172028 |
MIM | 107266 |
UniProt ID | P20273 |
◆ Recombinant Proteins | ||
CD22-8854CP | Recombinant Rhesus CD22 protein, Fc-tagged, R-PE labeled | +Inquiry |
CD22-1212R | Recombinant Rhesus macaque CD22 protein, His-tagged | +Inquiry |
CD22-562HA | Recombinant Human CD22 protein, Fc-tagged, APC labeled | +Inquiry |
CD22-482HAF555 | Active Recombinant Human CD22 Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
CD22-273HB | Active Recombinant Human CD22 protein, His-Avi-tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD22-1956HCL | Recombinant Human CD22 cell lysate | +Inquiry |
CD22-001MCL | Recombinant Mouse CD22 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD22 Products
Required fields are marked with *
My Review for All CD22 Products
Required fields are marked with *
0
Inquiry Basket