Recombinant Human CD200 Protein, GST-Tagged

Cat.No. : CD200-0742H
Product Overview : Human CD200 partial ORF (NP_005935, 34 a.a. - 124 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a type I membrane glycoprotein containing two extracellular immunoglobulin domains, a transmembrane and a cytoplasmic domain. This gene is expressed by various cell types, including B cells, a subset of T cells, thymocytes, endothelial cells, and neurons. The encoded protein plays an important role in immunosuppression and regulation of anti-tumor activity. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jan 2016]
Molecular Mass : 35.75 kDa
AA Sequence : VVTQDEREQLYTPASLKCSLQNAQEALIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYMCLFN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CD200 CD200 molecule [ Homo sapiens ]
Official Symbol CD200
Synonyms CD200; CD200 molecule; antigen identified by monoclonal MRC OX 2, CD200 antigen, MOX1, MOX2; OX-2 membrane glycoprotein; MRC; OX 2; CD200 antigen; MRC OX-2 antigen; antigen identified by monoclonal MRC OX-2; MOX1; MOX2; OX-2;
Gene ID 4345
mRNA Refseq NM_001004196
Protein Refseq NP_001004196
MIM 155970
UniProt ID P41217

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CD200 Products

Required fields are marked with *

My Review for All CD200 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon