Recombinant Human CD200 Protein, GST-Tagged

• Cat.No.: CD200-0742H
• Product Overview: Human CD200 partial ORF (NP_005935, 34 a.a. - 124 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a type I membrane glycoprotein containing two extracellular immunoglobulin domains, a transmembrane and a cytoplasmic domain. This gene is expressed by various cell types, including B cells, a subset of T cells, thymocytes, endothelial cells, and neurons. The encoded protein plays an important role in immunosuppression and regulation of anti-tumor activity. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jan 2016]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 35.75 kDa
• AA Sequence: VVTQDEREQLYTPASLKCSLQNAQEALIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYMCLFN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CD200 CD200 molecule [ Homo sapiens ]
• Official Symbol: CD200
• Synonyms: CD200; CD200 molecule; antigen identified by monoclonal MRC OX 2, CD200 antigen, MOX1, MOX2; OX-2 membrane glycoprotein; MRC; OX 2; CD200 antigen; MRC OX-2 antigen; antigen identified by monoclonal MRC OX-2; MOX1; MOX2; OX-2
• Gene ID: 4345
• mRNA Refseq: NM_001004196
• Protein Refseq: NP_001004196
• MIM: 155970
• UniProt ID: P41217