Recombinant Human CD1D protein, His-SUMO-tagged
Cat.No. : | CD1D-2659H |
Product Overview : | Recombinant Human CD1D protein(P15813)(20-301aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 20-301aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 47.9 kDa |
AA Sequence : | EVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYWGGSYTS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CD1D CD1d molecule [ Homo sapiens ] |
Official Symbol | CD1D |
Synonyms | CD1D; CD1d molecule; CD1d antigen , CD1D antigen, d polypeptide; antigen-presenting glycoprotein CD1d; R3G1; thymocyte antigen CD1D; CD1D antigen, d polypeptide; T-cell surface glycoprotein CD1d; differentiation antigen CD1-alpha-3; HMC class I antigen-like glycoprotein CD1D; R3; CD1A; MGC34622; |
Gene ID | 912 |
mRNA Refseq | NM_001766 |
Protein Refseq | NP_001757 |
MIM | 188410 |
UniProt ID | P15813 |
◆ Recombinant Proteins | ||
RFL4802OF | Recombinant Full Length Sheep Antigen-Presenting Glycoprotein Cd1D(Cd1D) Protein, His-Tagged | +Inquiry |
CD1D-828H | Recombinant Human CD1D Protein, Fc-tagged | +Inquiry |
CD1D-2188H | Recombinant Human CD1D, His tagged | +Inquiry |
CD1D-550R | Recombinant Rhesus Macaque CD1D Protein, His (Fc)-Avi-tagged | +Inquiry |
CD1D-64HF | Recombinant Full Length Human CD1D Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD1D-2479HCL | Recombinant Human CD1D cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD1D Products
Required fields are marked with *
My Review for All CD1D Products
Required fields are marked with *
0
Inquiry Basket