Recombinant Human CD1D protein, His-SUMO-tagged

• Cat.No.: CD1D-2659H
• Product Overview: Recombinant Human CD1D protein(P15813)(20-301aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 20-301aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 47.9 kDa
• AA Sequence: EVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYWGGSYTS
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: CD1D CD1d molecule [ Homo sapiens ]
• Official Symbol: CD1D
• Synonyms: CD1D; CD1d molecule; CD1d antigen , CD1D antigen, d polypeptide; antigen-presenting glycoprotein CD1d; R3G1; thymocyte antigen CD1D; CD1D antigen, d polypeptide; T-cell surface glycoprotein CD1d; differentiation antigen CD1-alpha-3; HMC class I antigen-like glycoprotein CD1D; R3; CD1A; MGC34622
• Gene ID: 912
• mRNA Refseq: NM_001766
• Protein Refseq: NP_001757
• MIM: 188410
• UniProt ID: P15813