Recombinant Human CD1C protein, His-tagged
Cat.No. : | CD1C-3969H |
Product Overview : | Recombinant Human CD1C protein(18-118 aa), fused to His tag, was expressed in E. coli. |
Availability | April 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 18-118 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | NADASQEHVSFHVIQIFSFVNQSWARGQGSGWLDELQTHGWDSESGTIIFLHNWSKGNFSNEELSDLELLFRFYLFGLTREIQDHASQDYSKYPFEVQVKA |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CD1C CD1c molecule [ Homo sapiens ] |
Official Symbol | CD1C |
Synonyms | CD1C; CD1c molecule; CD1, CD1c antigen , CD1C antigen, c polypeptide; T-cell surface glycoprotein CD1c; CD1C antigen, c polypeptide; cortical thymocyte antigen CD1C; differentiation antigen CD1-alpha-3; R7; CD1; CD1A; BDCA1; |
Gene ID | 911 |
mRNA Refseq | NM_001765 |
Protein Refseq | NP_001756 |
MIM | 188340 |
UniProt ID | P29017 |
◆ Recombinant Proteins | ||
CD1c-1456H | Recombinant Human CD1c Protein (Asn18-Met302), His tagged | +Inquiry |
CD1C-26669TH | Recombinant Human CD1C | +Inquiry |
CD1C-827H | Recombinant Human CD1C Protein, Fc-tagged | +Inquiry |
CD1C-151H | Recombinant Human CD1C Protein, DYKDDDDK-tagged | +Inquiry |
CD1C-318R | Recombinant Rhesus CD1C Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD1C-7682HCL | Recombinant Human CD1C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD1C Products
Required fields are marked with *
My Review for All CD1C Products
Required fields are marked with *
0
Inquiry Basket