Recombinant Human CD164 protein, T7/His-tagged

• Cat.No.: CD164-30H
• Product Overview: Recombinant human CD164 extracellular domain cDNA (24 - 162 aa) fused with 29 N-terminal T7/His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• Protein Length: 24-162 a.a.
• Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFDKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVS CFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGT TNNTVTPTSQPVRKSTFD
• Purity: >90% by SDS-PAGE
• Applications: 1. Protein can be used as coating matrix protein for study human HSC / Recceptor interaction in vitro.2. As highly purified protein, may be used as culture matrix protein for regulation of HSC differentiation study in vitro.
• Storage: Keep at -20centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.

Gene Information

• Gene Name: CD164 CD164 molecule, sialomucin [ Homo sapiens ]
• Official Symbol: CD164
• Synonyms: CD164; CD164 molecule, sialomucin; CD164 antigen, sialomucin; sialomucin core protein 24; MGC 24; MUC 24; MGC-24v; multi-glycosylated core protein 24; MGC-24; MUC-24; endolyn
• Gene ID: 8763
• mRNA Refseq: NM_001142401
• Protein Refseq: NP_001135873
• MIM: 603356
• UniProt ID: Q04900
• Chromosome Location: 6q21
• Pathway: Lysosome, organism-specific biosystem; Lysosome, conserved biosystem
• Function: protein binding