Recombinant Human CD164 protein, T7/His-tagged
| Cat.No. : | CD164-30H |
| Product Overview : | Recombinant human CD164 extracellular domain cDNA (24 - 162 aa) fused with 29 N-terminal T7/His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Source : | E. coli |
| Species : | Human |
| Tag : | His&T7 |
| Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFDKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVS CFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGT TNNTVTPTSQPVRKSTFD |
| Purity : | >90% by SDS-PAGE |
| Applications : | 1. Protein can be used as coating matrix protein for study human HSC / Recceptor interaction in vitro.2. As highly purified protein, may be used as culture matrix protein for regulation of HSC differentiation study in vitro. |
| Storage : | Keep at -20centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
| Protein length : | 24-162 a.a. |
| Gene Name | CD164 CD164 molecule, sialomucin [ Homo sapiens ] |
| Official Symbol | CD164 |
| Synonyms | CD164; CD164 molecule, sialomucin; CD164 antigen, sialomucin; sialomucin core protein 24; MGC 24; MUC 24; MGC-24v; multi-glycosylated core protein 24; MGC-24; MUC-24; endolyn; |
| Gene ID | 8763 |
| mRNA Refseq | NM_001142401 |
| Protein Refseq | NP_001135873 |
| MIM | 603356 |
| UniProt ID | Q04900 |
| Chromosome Location | 6q21 |
| Pathway | Lysosome, organism-specific biosystem; Lysosome, conserved biosystem; |
| Function | protein binding; |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD164 Products
Required fields are marked with *
My Review for All CD164 Products
Required fields are marked with *
0
Inquiry Basket
