Recombinant Human CD163L1 protein(48-469aa), His&Myc-tagged

• Cat.No.: CD163L1-6432H
• Product Overview: Recombinant Human CD163L1 protein(Q9NR16)(48-469aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Human
• Tag: N-His&C-Myc
• Protein length: 48-469aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 54.1 kDa
• AASequence: LRLVNGDGPCSGTVEVKFQGQWGTVCDDGWNTTASTVVCKQLGCPFSFAMFRFGQAVTRHGKIWLDDVSCYGNESALWECQHREWGSHNCYHGEDVGVNCYGEANLGLRLVDGNNSCSGRVEVKFQERWGTICDDGWNLNTAAVVCRQLGCPSSFISSGVVNSPAVLRPIWLDDILCQGNELALWNCRHRGWGNHDCSHNEDVTLTCYDSSDLELRLVGGTNRCMGRVELKIQGRWGTVCHHKWNNAAADVVCKQLGCGTALHFAGLPHLQSGSDVVWLDGVSCSGNESFLWDCRHSGTVNFDCLHQNDVSVICSDGADLELRLADGSNNCSGRVEVRIHEQWWTICDQNWKNEQALVVCKQLGCPFSVFGSRRAKPSNEARDIWINSISCTGNESALWDCTYDGKAKRTCFRRSDAGVICS
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: CD163L1 CD163 molecule-like 1 [ Homo sapiens ]
• Official Symbol: CD163L1
• Synonyms: CD163L1; CD163 molecule-like 1; CD163 antigen like 1; scavenger receptor cysteine-rich type 1 protein M160; CD163B; M160; CD163 antigen B; CD163 antigen-like 1
• Gene ID: 283316
• mRNA Refseq: NM_174941
• Protein Refseq: NP_777601
• MIM: 606079
• UniProt ID: Q9NR16