Recombinant Human CD14 Protein, His-tagged
Cat.No. : | CD14-123H |
Product Overview : | Recombinant human CD14 protein with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 375 |
Description : | The protein encoded by this gene is a surface antigen that is preferentially expressed on monocytes/macrophages. It cooperates with other proteins to mediate the innate immune response to bacterial lipopolysaccharide, and to viruses. This gene has been identified as a target candidate in the treatment of SARS-CoV-2-infected patients to potentially lessen or inhibit a severe inflammatory response. Alternative splicing results in multiple transcript variants encoding the same protein. |
Form : | Lyophilized |
Molecular Mass : | 36.6 kDa |
AA Sequence : | MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQGARGFA |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | CD14 CD14 molecule [ Homo sapiens (human) ] |
Official Symbol | CD14 |
Synonyms | CD14; CD14 molecule; CD14 antigen; monocyte differentiation antigen CD14; myeloid cell-specific leucine-rich glycoprotein; |
Gene ID | 929 |
mRNA Refseq | NM_000591 |
Protein Refseq | NP_000582 |
MIM | 158120 |
UniProt ID | P08571 |
◆ Recombinant Proteins | ||
CD14-4993H | Recombinant Human CD14 protein, His-tagged | +Inquiry |
CD14-102H | Active Recombinant Human CD14 protein, His-tagged | +Inquiry |
CD14-4823H | Active Recombinant Human CD14 protein, mFc-tagged | +Inquiry |
Cd14-7484R | Recombinant Rat Cd14 protein(Met1-Tyr341), hFc-tagged | +Inquiry |
Cd14-117M | Active Recombinant Mouse Cd14 Protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD14-1169CCL | Recombinant Cynomolgus CD14 cell lysate | +Inquiry |
CD14-1469RCL | Recombinant Rat CD14 cell lysate | +Inquiry |
CD14-2581MCL | Recombinant Mouse CD14 cell lysate | +Inquiry |
CD14-1604HCL | Recombinant Human CD14 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD14 Products
Required fields are marked with *
My Review for All CD14 Products
Required fields are marked with *
0
Inquiry Basket