Recombinant Human CCT4, His-tagged

Cat.No. : CCT4-27952TH
Product Overview : Recombinant fragment, corresponding to amino acids 266-539 of Human TCP1 delta with a N terminal His tag; predicted MWt 31 kDa:
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 266-539 a.a.
Description : The chaperonin containing TCP1 (MIM 186980) complex (CCT), also called the TCP1 ring complex, consists of 2 back-to-back rings, each containing 8 unique but homologous subunits, such as CCT4. CCT assists the folding of newly translated polypeptide substrates through multiple rounds of ATP-driven release and rebinding of partially folded intermediate forms. Substrates of CCT include the cytoskeletal proteins actin (see MIM 102560) and tubulin (see MIM 191130), as well as alpha-transducin (MIM 139330) (Won et al.
Conjugation : HIS
Form : Lyophilised:reconstitution with 156 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : VSDYAQMDRVLREERAYILNLVKQIKKTGCNVLLIQKSIL RDALSDLALHFLNKMKIMVIKDIEREDIEFICKTIGTK PVAHIDQFTADMLGSAELAEEVNLNGSGKLLKITGCAS PGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRAL IAGGGAPEIELALRLTEYSRTLSGMESYCVRAFADAME VIPSTLAENAGLNPISTVTELRNRHAQGEKTAGINVRK GGISNILEELVVQPLLVSVSALTLATETVRSILKIDDV VNTR
Gene Name CCT4 chaperonin containing TCP1, subunit 4 (delta) [ Homo sapiens ]
Official Symbol CCT4
Synonyms CCT4; chaperonin containing TCP1, subunit 4 (delta); T-complex protein 1 subunit delta; Cctd;
Gene ID 10575
mRNA Refseq NM_006430
Protein Refseq NP_006421
MIM 605142
Uniprot ID P50991
Chromosome Location 2p15
Pathway Association of TriC/CCT with target proteins during biosynthesis, organism-specific biosystem; Chaperonin-mediated protein folding, organism-specific biosystem; Cooperation of Prefoldin and TriC/CCTin actin and tubulin folding, organism-specific biosystem; Folding of actin by CCT/TriC, organism-specific biosystem; Formation of tubulin folding intermediates by CCT/TriC, organism-specific biosystem;
Function ATP binding; nucleotide binding; unfolded protein binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CCT4 Products

Required fields are marked with *

My Review for All CCT4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon