Recombinant Human CCR8 Transmembrane protein, His-tagged

• Cat.No.: CCR8-1479H
• Product Overview: Recombinant Human CCR8 protein(P51685)(74-129aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Source: In vitro E. coli expression system
• Species: Human
• Tag: His
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 9.4 kDa
• Protein length: 74-129aa
• AA Sequence: LLNLALSDLLFVFSFPFQTYYLLDQWVFGTVMCKVVSGFYYIGFYSSMFFITLMSV
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: CCR8 chemokine (C-C motif) receptor 8 [ Homo sapiens ]
• Official Symbol: CCR8
• Synonyms: CCR8; chemokine (C-C motif) receptor 8; CMKBR8, CMKBRL2; C-C chemokine receptor type 8; CDw198; CKR L1; CY6; GPR CY6; TER1; CC chemokine receptor 8; chemokine receptor-like 1; chemokine (C-C) receptor 8; CC chemokine receptor CHEMR1; CC-chemokine receptor chemr1; chemokine (C-C) receptor-like 2; CCR-8; CKRL1; CMKBR8; GPRCY6; CMKBRL2; CC-CKR-8; MGC129966; MGC129973
• Gene ID: 1237
• mRNA Refseq: NM_005201
• Protein Refseq: NP_005192
• MIM: 601834
• UniProt ID: P51685