Recombinant Human CCR8 Transmembrane protein, His-tagged
Cat.No. : | CCR8-1479H |
Product Overview : | Recombinant Human CCR8 protein(P51685)(74-129aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 74-129aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 9.4 kDa |
AA Sequence : | LLNLALSDLLFVFSFPFQTYYLLDQWVFGTVMCKVVSGFYYIGFYSSMFFITLMSV |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CCR8 chemokine (C-C motif) receptor 8 [ Homo sapiens ] |
Official Symbol | CCR8 |
Synonyms | CCR8; chemokine (C-C motif) receptor 8; CMKBR8, CMKBRL2; C-C chemokine receptor type 8; CDw198; CKR L1; CY6; GPR CY6; TER1; CC chemokine receptor 8; chemokine receptor-like 1; chemokine (C-C) receptor 8; CC chemokine receptor CHEMR1; CC-chemokine receptor chemr1; chemokine (C-C) receptor-like 2; CCR-8; CKRL1; CMKBR8; GPRCY6; CMKBRL2; CC-CKR-8; MGC129966; MGC129973; |
Gene ID | 1237 |
mRNA Refseq | NM_005201 |
Protein Refseq | NP_005192 |
MIM | 601834 |
UniProt ID | P51685 |
◆ Recombinant Proteins | ||
CCR8-0184H | Active Recombinant Human CCR8 protein | +Inquiry |
RFL17422HF | Recombinant Full Length Human C-C Chemokine Receptor Type 8(Ccr8) Protein, His-Tagged | +Inquiry |
CCR8-01M | Recombinant Mouse CCR8 Protein, hFc-Tagged | +Inquiry |
CCR8-1457H | Recombinant Human CCR8 protein, hFc-tagged | +Inquiry |
CCR8-0698H | Recombinant Human CCR8 Protein, GST-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCR8 Products
Required fields are marked with *
My Review for All CCR8 Products
Required fields are marked with *
0
Inquiry Basket