Recombinant Human CCR5, GST-tagged

• Cat.No.: CCR5-120H
• Product Overview: CCR5 (XP_001125981.1, 1 a.a. - 352 a.a.) recombinant protein with a ~26kD N-terminal GST tag..

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1-352 a.a.
• Description: This gene encodes a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. This protein is expressed by T cells and macrophages, and is known to be an important co-receptor for macrophage-tropic virus, including HIV, to enter host cells. Defective alleles of this gene have been associated with the HIV infection resistance. The ligands of this receptor include monocyte chemoattractant protein 2 (MCP-2), macrophage inflammatory protein 1 alpha (MIP-1 alpha), macrophage inflammatory protein 1 beta (MIP-1 beta) and regulated on activation normal T expressed and secreted protein (RANTES). Expression of this gene was also detected in a promyeloblastic cell line, suggesting that this protein may play a role in granulocyte lineage proliferation and differentiation. This gene is located at the chemokine receptor gene cluster region. Two transcript variants encoding the same protein have been found for this gene.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 66.9 kDa
• AA Sequence: MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLLNLAIS DLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIF FIILLTIDRYLAVVHAVFALKARTVTFGVVTS VITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRC RNEKKRHRAV RLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYA FVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
• Applications: Western Blot; ELISA; Protein Array; Antibody Production
• Storage: Store at -80C. Avoid freeze-thaw cycles.

Gene Information

• Gene Name: CCR5 chemokine (C-C motif) receptor 5 (gene/pseudogene) [ Homo sapiens (human) ]
• Official Symbol: CCR5
• Synonyms: CCR5; CKR5; CCR-5; CD195; CKR-5; CCCKR5; CMKBR5; IDDM22; CC-CKR-5; chemokine (C-C motif) receptor 5 (gene/pseudogene); C-C chemokine receptor type 5; chemr13; HIV-1 fusion coreceptor; chemokine receptor CCR5; C-C motif chemokine receptor 5 A159A
• Gene ID: 1234
• mRNA Refseq: NM_000579
• Protein Refseq: NP_000570
• MIM: 601373
• UniProt ID: P51681
• Chromosome Location: 3p21.31
• Pathway: Binding and entry of HIV virion; Chemokine receptors bind chemokines; Class A/1 (Rhodopsin-like receptors)
• Function: C-C chemokine binding; chemokine (C-C motif) ligand 5 binding; phosphatidylinositol phospholipase C activity