Recombinant Human CCNG1, His-tagged

Cat.No. : CCNG1-26094TH
Product Overview : Recombinant full length Human Cyclin G with an N-terminal His tag. 315 amino acides with a predicted MWt34 kDa including the tag
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 295 amino acids
Description : The eukaryotic cell cycle is governed by cyclin-dependent protein kinases (CDKs) whose activities are regulated by cyclins and CDK inhibitors. The protein encoded by this gene is a member of the cyclin family and contains the cyclin box. The encoded protein lacks the protein destabilizing (PEST) sequence that is present in other family members. Transcriptional activation of this gene can be induced by tumor protein p53. Two transcript variants encoding the same protein have been identified for this gene.
Conjugation : HIS
Molecular Weight : 36.200kDa inclusive of tags
Tissue specificity : High levels in skeletal muscle, ovary, kidney and colon.
Form : Liquid
Purity : by SDS-PAGE
Storage buffer : pH: 8.00Constituents:1.17% Sodium chloride, 0.08% DTT, 50% Glycerol, 0.32% Tris HCl
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMIEVLTTTDSQKLLHQLNAL LEQESRCQPKVCGLRLIESAHDNGLRMTARLRDFEVKDLL SLTQFFGFDTETFSLAVNLLDRFLSKMKVQPKHLGCVGLS CFYLAVKSIEEERNVPLATDLIRISQYRFTVSDLMRMEKI VLEKVCWKVKATTAFQFLQLYYSLLQENLPLERRNSINFE RLEAQLKACHCRIIFSKAKPSVLALSIIALEIQAQKCVEL TEGIECLQKHSKINGRDLTFWQELVSKCLTEYSSNKCSKP NVQKLKWIVSGRTARQLKHSYYRITHLPTIPEMVP
Sequence Similarities : Belongs to the cyclin family. Cyclin G subfamily.
Gene Name CCNG1 cyclin G1 [ Homo sapiens ]
Official Symbol CCNG1
Synonyms CCNG1; cyclin G1; CCNG; cyclin-G1;
Gene ID 900
mRNA Refseq NM_004060
Protein Refseq NP_004051
MIM 601578
Uniprot ID P51959
Chromosome Location 5q32-q34
Pathway Direct p53 effectors, organism-specific biosystem; p53 pathway, organism-specific biosystem; p53 signaling pathway, organism-specific biosystem; p53 signaling pathway, conserved biosystem;
Function protein domain specific binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CCNG1 Products

Required fields are marked with *

My Review for All CCNG1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon