Recombinant Human CCNB1IP1 Protein, GST-Tagged

• Cat.No.: CCNB1IP1-0652H
• Product Overview: Human CCNB1IP1 full-length ORF (NP_878269.1, 1 a.a. - 277 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: HEI10 is a member of the E3 ubiquitin ligase family and functions in progression of the cell cycle through G(2)/M.[supplied by OMIM, Apr 2004]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 57.9 kDa
• AA Sequence: MSLCEDMLLCNYRKCRIKLSGYAWVTACSHIFCDQHGSGEFSRSPAICPACNSTLSGKLDIVRTELSPSEEYKAMVLAGLRPEIVLDISSRALAFWTYQVHQERLYQEYNFSKAEGHLKQMEKIYTQQIQSKDVELTSMKGEVTSMKKVLEEYKKKFSDISEKLMERNRQYQKLQGLYDSLRLRNITIANHEGTLEPSMIAQSGVLGFPLGNNSKFPLDNTPVRNRGDGDGDFQFRPFFAGSPTAPEPSNSFFSFVSPSRELEQQQVSSRAFKVKRI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CCNB1IP1 cyclin B1 interacting protein 1, E3 ubiquitin protein ligase [ Homo sapiens ]
• Official Symbol: CCNB1IP1
• Synonyms: CCNB1IP1; cyclin B1 interacting protein 1, E3 ubiquitin protein ligase; C14orf18, chromosome 14 open reading frame 18, cyclin B1 interacting protein 1; E3 ubiquitin-protein ligase CCNB1IP1; HEI10; human enhancer of invasion 10; enhancer of invasion 10; cyclin-B1-interacting protein 1; C14orf18
• Gene ID: 57820
• mRNA Refseq: NM_021178
• Protein Refseq: NP_067001
• MIM: 608249
• UniProt ID: Q9NPC3