Recombinant Human CCL5 Protein, GST-Tagged

• Cat.No.: CCL5-0642H
• Product Overview: Human CCL5 full-length ORF (AAH08600, 1 a.a. - 91 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CC subfamily, functions as a chemoattractant for blood monocytes, memory T helper cells and eosinophils. It causes the release of histamine from basophils and activates eosinophils. This cytokine is one of the major HIV-suppressive factors produced by CD8+ cells. It functions as one of the natural ligands for the chemokine receptor chemokine (C-C motif) receptor 5 (CCR5), and it suppresses in vitro replication of the R5 strains of HIV-1, which use CCR5 as a coreceptor. Alternative splicing results in multiple transcript variants that encode different isoforms. [provided by RefSeq, Jul 2013]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 35.75 kDa
• AA Sequence: MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CCL5 chemokine (C-C motif) ligand 5 [ Homo sapiens ]
• Official Symbol: CCL5
• Synonyms: CCL5; chemokine (C-C motif) ligand 5; D17S136E, SCYA5, small inducible cytokine A5 (RANTES); C-C motif chemokine 5; beta chemokine RANTES; MGC17164; RANTES; regulated upon activation; normally T expressed; and presumably secreted; SIS delta; SISd; small inducible cytokine subfamily A (Cys Cys); member 5; T cell specific protein p288; T cell specific RANTES protein; TCP228; eoCP; SIS-delta; beta-chemokine RANTES; small-inducible cytokine A5; T-cell specific protein p288; t cell-specific protein P228; T-cell-specific protein RANTES; eosinophil chemotactic cytokine; small inducible cytokine A5 (RANTES); small inducible cytokine subfamily A (Cys-Cys), member 5; regulated upon activation, normally T-expressed, and presumably secreted; SCYA5; D17S136E
• Gene ID: 6352
• mRNA Refseq: NM_002985
• Protein Refseq: NP_002976
• MIM: 187011
• UniProt ID: P13501