Active Recombinant Mouse/Rat CCL5 Protein

• Cat.No.: Ccl5-28M
• Product Overview: Recombinant Mouse/Rat CCL5 Protein without tag was expressed in E. coli.

Specification

• Species: Mouse/Rat
• Source: E.coli
• Description: Regulated upon activation, normal T cell expressed and secreted (RANTES), also called CCL5, is a chemokine produced by T cells three to five days after T cell activation. RANTES signals through G protein-coupled receptors CCR5, CCR3, CCR1, and through the human CMV-encoded viral receptor US28. RANTES functions to recruit immune cells to inflammatory sites.
• Bio-activity: THP-1 chemotaxis, ≤250 ng/mL
• Molecular Mass: Monomer, 7.9 kDa (68 aa)
• AA Sequence: SPYGSDTTPCCFAYLSLALPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCANPEKKWVQEYINYLEMS
• Endotoxin: ≤1 EUs/μg, Kinetic LAL
• Purity: ≥95%, Reducing and Non-Reducing SDS PAGE
• Stability: 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
  1 month when stored at 4 centigrade after reconstituting as directed.
  3 months when stored at -20 to -80 centigrade after reconstituting as directed.
• Storage: Storage Prior to Reconstitution: -20 centigrade
• Storage Buffer: Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
• Reconstitution: Sterile water at 0.1 mg/mL
• Shipping: Room temperature
• Instructions: Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.

Gene Information

• Gene Name: Ccl5 chemokine (C-C motif) ligand 5 [ Mus musculus (house mouse) ]
• Official Symbol: Ccl5
• Synonyms: CCL5; chemokine (C-C motif) ligand 5; C-C motif chemokine 5; SIS-delta; small inducible cytokine A5; small-inducible cytokine A5; T-cell-specific protein RANTES; SISd; Scya5; RANTES; TCP228; MuRantes
• Gene ID: 20304
• mRNA Refseq: NM_013653
• Protein Refseq: NP_038681
• UniProt ID: Q5XZF2