Recombinant Human CCL5 Protein
Cat.No. : | CCL5-43H |
Product Overview : | Recombinant Human CCL5 Protein was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 67 amino acid |
Description : | Human CCL5, also known as Regulated upon Activation, Normal T cell Expressed and presumably Secreted (RANTES), attracts and activates leukocytes and plays a primary role in the inflammatory immune response. CCL5 activates several G protein-coupled receptors including CCRs 1, 3, 4, and 5. CCL5 binding to CCR5 inhibits the infectivity of M-tropic HIV-1 strains. Proteolytic removal of the two N-terminal residues by CD26 generates a CCL5 variant that functions as a more potent HIV-1 inhibitor and a CCR5 antagonist. |
Form : | Lyophilized |
Molecular Mass : | 7.84701 kDa |
AA Sequence : | SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQ VCANPEKKWVREYINSLEMS |
Endotoxin : | Endotoxin-free <0.01 EU/ug |
Purity : | Purity assessed by HPLC, Mass Spectrometry, and NMR |
Storage : | Store at -20 to -80 centigrade for 12 months; Store at 4 centigrade for 6 months; Store at RT for 1 month. |
tmpcolum67 : | C-C motif chemokine ligand 5 |
Gene Name | CCL5 C-C motif chemokine ligand 5 [ Homo sapiens (human) ] |
Official Symbol | CCL5 |
Synonyms | SISd; eoCP; SCYA5; RANTES; TCP228; D17S136E; SIS-delta |
Gene ID | 6352 |
mRNA Refseq | NM_002985 |
Protein Refseq | NP_002976 |
MIM | 187011 |
UniProt ID | P13501 |
◆ Recombinant Proteins | ||
CCL5-521H | Recombinant Human CCL5 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCL5-57H | Recombinant Human CCL5 Protein, Biotin-tagged | +Inquiry |
CCL5-1068HFL | Active Recombinant Full Length Human CCL5 Protein, C-Flag-tagged | +Inquiry |
CCL5-511H | Active Recombinant Mouse Chemokine (C-C motif) Ligand 5, HIgG1 Fc-tagged, mutant | +Inquiry |
CCL5-82H | Recombinant Human CCL5 protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL5-2706HCL | Recombinant Human CCL5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCL5 Products
Required fields are marked with *
My Review for All CCL5 Products
Required fields are marked with *
0
Inquiry Basket