Recombinant Human CCL4 Protein
Cat.No. : | CCL4-25H |
Product Overview : | Recombinant Human CCL4 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | Macrophage inflammatory protein-1 beta , also known as CCL4, is produced by macrophages and functions as a mitogen-inducible cytokine. MIP-1 signals through the chemokine receptor CCR5 to chemoattract immune cells. MIP-1 induces inflammatory responses, including neutrophil superoxide production. The MIP-1 and MIP-1 heterodimer exhibits antiviral activity against the human immunodeficiency virus 1 (HIV-1). |
Bio-activity : | No biological activity data is available at this time. |
Molecular Mass : | Monomer, 7.8 kDa (69 aa) |
AA Sequence : | APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRGKQVCADPSESWVQEYVYDLELN |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | CCL4 chemokine (C-C motif) ligand 4 [ Homo sapiens (human) ] |
Official Symbol | CCL4 |
Synonyms | CCL4; chemokine (C-C motif) ligand 4; LAG1, SCYA4, small inducible cytokine A4 (homologous to mouse Mip 1b); C-C motif chemokine 4; Act 2; AT744.1; MIP 1 beta; PAT 744; SIS-gamma; MIP-1-beta(1-69); CC chemokine ligand 4; secreted protein G-26; T-cell activation protein 2; small-inducible cytokine A4; lymphocyte-activation gene 1; G-26 T-lymphocyte-secreted protein; lymphocyte activation gene 1 protein; macrophage inflammatory protein 1-beta; small inducible cytokine A4 (homologous to mouse Mip-1b); ACT2; G-26; HC21; LAG1; LAG-1; MIP1B; SCYA2; SCYA4; MIP1B1; MIP-1-beta; MGC104418; MGC126025; MGC126026; |
Gene ID | 6351 |
mRNA Refseq | NM_002984 |
Protein Refseq | NP_002975 |
MIM | 182284 |
UniProt ID | P13236 |
◆ Recombinant Proteins | ||
CCL4-710H | Recombinant Human CCL4 protein, His & GST-tagged | +Inquiry |
CCL4-146S | Recombinant Swine Chemokine (C-C motif) Ligand 4 | +Inquiry |
CCL4-6531H | Recombinant Human CCL4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CCL4-77H | Recombinant Human CCL4 | +Inquiry |
Ccl4-634R | Recombinant Rat Ccl4 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL4-7721HCL | Recombinant Human CCL4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCL4 Products
Required fields are marked with *
My Review for All CCL4 Products
Required fields are marked with *
0
Inquiry Basket