Recombinant Mouse Ccl4 protein

• Cat.No.: Ccl4-615M
• Product Overview: Recombinant Mouse Ccl4 protein was expressed in Escherichia coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: Non
• Protein Length: 69
• Description: Chemokine (C-C motif) ligand 4, also known as Macrophage inflammatory protein-1β (MIP-1β) is a CC chemokine with specificity for CCR5 receptors and it is a major HIV-suppressive factor produced by CD8+ T cells. In addition, it is a monokine with inflammatory and chemokinetic properties. Recombinant CCL4 induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). Furthermore, recombinant murine CCL4 contains 69 amino acids and it shares 77 % and 86 % a.a. sequence identity with human and rat CCL4. Both human and murine MIP-1α and MIP-1β are active on human and murine hematopoietic cells.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in 2 × PBS, pH 7.4.
• Bio-activity: Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration range of 20-100 ng/ml.
• Molecular Mass: Approximately 7.8 kDa, a single non-glycosylated polypeptide chain containing 69 amino acids.
• AA Sequence: APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN
• Endotoxin: Less than 1 EU/µg of rMuMIP-1β/CCL4 as determined by LAL method.
• Purity: >97% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: Ccl4
• Official Symbol: Ccl4
• Synonyms: CCL4; chemokine (C-C motif) ligand 4; C-C motif chemokine 4; ACT2; SIS-gamma; MIP-1 beta; MIP-1-beta; immune activation protein 2; small inducible cytokine A4; small-inducible cytokine A4; macrophage inflammatory protein 1-beta; Act-2; Mip1b; Scya4; MIP-1B; AT744.1
• Gene ID: 20303
• mRNA Refseq: NM_013652
• Protein Refseq: NP_038680
• UniProt ID: P14097