Recombinant Human CCL3L1 Protein, GST-Tagged

Cat.No. : CCL3L1-0639H
Product Overview : Human CCL3L1 full-length ORF (AAH27888.1, 1 a.a. - 93 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is one of several cytokine genes that are clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins that function in inflammatory and immunoregulatory processes. The protein encoded by this gene binds to several chemokine receptors, including chemokine binding protein 2 and chemokine (C-C motif) receptor 5 (CCR5). CCR5 is a co-receptor for HIV, and binding of this protein to CCR5 inhibits HIV entry. The copy number of this gene varies among individuals, where most individuals have one to six copies, and a minority of individuals have zero or more than six copies. There are conflicting reports about copy number variation of this gene and its correlation to disease susceptibility. This record represents one of two copies that are present on the ALT_REF_LOCI_2 alternate haplotype of the GRCh38 human reference genome assembly. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Apr 2014]
Molecular Mass : 35.97 kDa
AA Sequence : MQVSTAALAVLLCTMALCNQVLSAPLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CCL3L1 chemokine (C-C motif) ligand 3-like 1 [ Homo sapiens ]
Official Symbol CCL3L1
Synonyms CCL3L1; chemokine (C-C motif) ligand 3-like 1; D17S1718, SCYA3L, SCYA3L1, small inducible cytokine A3 like 1; C-C motif chemokine 3-like 1; G0S19 2; LD78BETA; PAT 464.2; LD78-beta(1-70); small inducible cytokine A3-like 1; small-inducible cytokine A3-like 1; G0/G1 switch regulatory protein 19-2; tonsillar lymphocyte LD78 beta protein; LD78; 464.2; MIP1AP; SCYA3L; G0S19-2; SCYA3L1; D17S1718; MGC12815; MGC104178; MGC182017;
Gene ID 6349
mRNA Refseq NM_021006
Protein Refseq NP_066286
MIM 601395
UniProt ID P16619

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CCL3L1 Products

Required fields are marked with *

My Review for All CCL3L1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon