Recombinant Human CCL3, His-tagged

• Cat.No.: CCL3-29859TH
• Product Overview: Recombinant full length Human Macrophage Inflammatory Protein 1 alpha / CCL3 with N terminal His tag; 90 amino acids with tag, Predicted MWt 10 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 69 amino acids
• Description: This locus represents a small inducible cytokine. The encoded protein, also known as macrophage inflammatory protein 1 alpha, plays a role in inflammatory responses through binding to the receptors CCR1, CCR4 and CCR5. Polymorphisms at this locus may be associated with both resistance and susceptibility to infection by human immunodeficiency virus type 1.
• Conjugation: HIS
• Molecular Weight: 10.000kDa inclusive of tags
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 10mM Sodium citrate, pH 3.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMSLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
• Sequence Similarities: Belongs to the intercrine beta (chemokine CC) family.

Gene Information

• Gene Name: CCL3 chemokine (C-C motif) ligand 3 [ Homo sapiens ]
• Official Symbol: CCL3
• Synonyms: CCL3; chemokine (C-C motif) ligand 3; SCYA3, small inducible cytokine A3 (homologous to mouse Mip 1a); C-C motif chemokine 3; G0S19 1; LD78ALPHA; MIP 1 alpha
• Gene ID: 6348
• mRNA Refseq: NM_002983
• Protein Refseq: NP_002974
• MIM: 182283
• Uniprot ID: P10147
• Chromosome Location: 17q12
• Pathway: Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem; Chemokine receptors bind chemokines, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem
• Function: chemoattractant activity; chemokine activity; signal transducer activity