Recombinant Human CCL28 Protein

• Cat.No.: CCL28-54H
• Product Overview: Recombinant Human CCL28 Protein was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 114 amino acid
• Description: Human CCL28 is chemokine that is constitutively expressed by epithelial cells in diverse mucosal tissues and is known to attract a variety of immune cell types including T-cell subsets and eosinophils through activation of the G protein-coupled receptors CCR10 and CCR3. CCL28 contains an extended C-terminal domain consisting of ~40 flexible amino acids. In addition to the two disulfide bonds that are conserved throughout the chemokine family, two additional cysteine residues at positions 30 and 80 form a novel disulfide linkage between the folded chemokine domain and the flexible C-terminus. Human CCL28 is expressed as an immature polypeptide 127 amino acids in length. Two different mature N-terminal sequences have been described due to uncertainty in the site of cleavage by signal peptidase. CCL28(4-108) is described in the NCIB GenPept entry as the mature form based on an ab initio prediction of the site of signal peptide cleavage. It consists of residues 23-127 of the expressed protein and may exhibit higher potency as a CCR10 agonist than the longer version [CCL28(1-108)] that includes three additional N-terminal residues.
• Form: Lyophilized
• Molecular Mass: 12.070 kDa
• AA Sequence: ILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQWMKV QAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY
• Endotoxin: Endotoxin-free <0.01 EU/ug
• Purity: Purity assessed by HPLC, Mass Spectrometry, and NMR
• Storage: Store at -20 to -80 centigrade for 12 months; Store at 4 centigrade for 6 months; Store at RT for 1 month.
• tmpcolum67: C-C motif chemokine ligand 28

Gene Information

• Gene Name: CCL28 C-C motif chemokine ligand 28 [ Homo sapiens (human) ]
• Official Symbol: CCL28
• Synonyms: MEC; CCK1; SCYA28
• Gene ID: 56477
• mRNA Refseq: NM_148672
• Protein Refseq: NP_683513
• MIM: 605240
• UniProt ID: Q9NRJ3