Recombinant Human CCL28 Protein
Cat.No. : | CCL28-54H |
Product Overview : | Recombinant Human CCL28 Protein was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 114 amino acid |
Description : | Human CCL28 is chemokine that is constitutively expressed by epithelial cells in diverse mucosal tissues and is known to attract a variety of immune cell types including T-cell subsets and eosinophils through activation of the G protein-coupled receptors CCR10 and CCR3. CCL28 contains an extended C-terminal domain consisting of ~40 flexible amino acids. In addition to the two disulfide bonds that are conserved throughout the chemokine family, two additional cysteine residues at positions 30 and 80 form a novel disulfide linkage between the folded chemokine domain and the flexible C-terminus. Human CCL28 is expressed as an immature polypeptide 127 amino acids in length. Two different mature N-terminal sequences have been described due to uncertainty in the site of cleavage by signal peptidase. CCL28(4-108) is described in the NCIB GenPept entry as the mature form based on an ab initio prediction of the site of signal peptide cleavage. It consists of residues 23-127 of the expressed protein and may exhibit higher potency as a CCR10 agonist than the longer version [CCL28(1-108)] that includes three additional N-terminal residues. |
Form : | Lyophilized |
Molecular Mass : | 12.070 kDa |
AA Sequence : | ILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQWMKV QAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY |
Endotoxin : | Endotoxin-free <0.01 EU/ug |
Purity : | Purity assessed by HPLC, Mass Spectrometry, and NMR |
Storage : | Store at -20 to -80 centigrade for 12 months; Store at 4 centigrade for 6 months; Store at RT for 1 month. |
tmpcolum67 : | C-C motif chemokine ligand 28 |
Gene Name | CCL28 C-C motif chemokine ligand 28 [ Homo sapiens (human) ] |
Official Symbol | CCL28 |
Synonyms | MEC; CCK1; SCYA28 |
Gene ID | 56477 |
mRNA Refseq | NM_148672 |
Protein Refseq | NP_683513 |
MIM | 605240 |
UniProt ID | Q9NRJ3 |
◆ Recombinant Proteins | ||
CCL28-2974M | Recombinant Mouse CCL28 Protein | +Inquiry |
CCL28-147H | Active Recombinant Human CCL28, HIgG1 Fc-tagged, mutant | +Inquiry |
Ccl28-7137R | Recombinant Rat Ccl28 protein, His & GST-tagged | +Inquiry |
CCL28-518R | Recombinant Rhesus Macaque CCL28 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCL28-193H | Recombinant Human CCL28 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL28-7724HCL | Recombinant Human CCL28 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCL28 Products
Required fields are marked with *
My Review for All CCL28 Products
Required fields are marked with *
0
Inquiry Basket