Recombinant Human CCL28 Protein, His-tagged
Cat.No. : | CCL28-193H |
Product Overview : | Recombinant Human CCL28 Protien(NP_683513)(1-127 aa), fused to His tag, was expressed in E. coli. |
Availability | February 23, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-127 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | MQQRGLAIVALAVCAALHASEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Gene Name | CCL28 chemokine (C-C motif) ligand 28 [ Homo sapiens ] |
Official Symbol | CCL28 |
Synonyms | CCL28; chemokine (C-C motif) ligand 28; C-C motif chemokine 28; CC chemokine CCL28; CCK1; MEC; mucosae associated epithelial chemokine; SCYA28; small inducible cytokine A28; small inducible cytokine subfamily A (Cys Cys); member 28; small-inducible cytokine A28; mucosae-associated epithelial chemokine; chemokine (C-C motif) ligand 28 splice variant chi; small inducible cytokine subfamily A (Cys-Cys), member 28; MGC71902; |
Gene ID | 56477 |
mRNA Refseq | NM_148672 |
Protein Refseq | NP_683513 |
MIM | 605240 |
UniProt ID | Q9NRJ3 |
◆ Recombinant Proteins | ||
CCL28-2974M | Recombinant Mouse CCL28 Protein | +Inquiry |
Ccl28-2036M | Active Recombinant Mouse Ccl28 Protein | +Inquiry |
CCL28-145H | Active Recombinant Human CCL28, MIgG2a Fc-tagged | +Inquiry |
CCL28-0634H | Recombinant Human CCL28 Protein, GST-Tagged | +Inquiry |
CCL28-518R | Recombinant Rhesus Macaque CCL28 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL28-7724HCL | Recombinant Human CCL28 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCL28 Products
Required fields are marked with *
My Review for All CCL28 Products
Required fields are marked with *
0
Inquiry Basket