Recombinant Human CCL26 Protein

• Cat.No.: CCL26-52H
• Product Overview: Recombinant Human CCL26 Protein was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 71 amino acid
• Description: Recombinant human CCL26 is expressed in E. coli, refolded and purified to yield a mature form of either 68 or 71 amino acids that is secreted from cells after cleavage of the signal peptide. Human CCL26, also known as IMAC, eotaxin 3, and MIP4-alpha, recruits eosinophils and basophils by activating the CCR3 receptor.
• Form: Lyophilized
• Molecular Mass: 8.39182 kDa
• AA Sequence: TRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCT HPRKKWVQKYISLLKTPKQL
• Endotoxin: Endotoxin-free <0.01 EU/ug
• Purity: Purity assessed by HPLC, Mass Spectrometry, and NMR
• Storage: Store at -20 to -80 centigrade for 12 months; Store at 4 centigrade for 6 months; Store at RT for 1 month.
• tmpcolum67: C-C motif chemokine ligand 26

Gene Information

• Gene Name: CCL26 C-C motif chemokine ligand 26 [ Homo sapiens (human) ]
• Official Symbol: CCL26
• Synonyms: IMAC; TSC-1; MIP-4a; SCYA26; MIP-4alpha
• Gene ID: 10344
• mRNA Refseq: NM_006072
• Protein Refseq: NP_006063
• MIM: 604697
• UniProt ID: Q9Y258