Active Recombinant Human CCL26 Protein (71 aa)

Cat.No. : CCL26-127C
Product Overview : Recombinant Human CCL26 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 71
Description : Eotaxin3, also named CCL26 or SCYA26, is a novel human CC chemokine coded by CXCL26 gene at chromosome 7 in human. Recombinant Eotaxin3/CCL26 has been produced in insect cells using a baculovirus expression system and shown to contain 71 aa residues. Recombinant Eotaxin3/CCL26 is chemotactic for eosinophils and PHAactivated T cells. Eotaxin3/CCL26 induces calcium flux in eosinophils as well as in CCR3 transfected cells. Eotaxin3/CCL26 has also been shown to crossdesensitize cells to other CCR3 ligands. Both the 71 aa residue and 68 aa residue variants of recombinant Eotaxin3 have been expressed in E. coli and found to have equal potency in inducing chemotaxis of a human CCR3 transfected cell line.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : Measured by its ability to chemoattract mouse CCR3 transfected BaF3 mouse proB cells. The ED50 for this effect is typically 0.3-0.5 μg/mL.
Molecular Mass : Approximately 8.4 kDa, a single non-glycosylated polypeptide chain containing 71 amino acid residues.
AA Sequence : TRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL
Endotoxin : Less than 1 EU/μg of rHuEotaxin-3/CCL26 as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analyses.
Storage : This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
Storage Buffer : Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name CCL26 chemokine (C-C motif) ligand 26 [ Homo sapiens ]
Official Symbol CCL26
Synonyms CCL26; chemokine (C-C motif) ligand 26; SCYA26, small inducible cytokine subfamily A (Cys Cys), member 26; C-C motif chemokine 26; CC chemokine IMAC; chemokine N1; eotaxin 3; IMAC; macrophage inflammatory protein 4 alpha; MIP 4a; MIP 4alpha; small inducible cytokine A26; thymic stroma chemokine 1; TSC 1; eotaxin-3; MIP-4-alpha; thymic stroma chemokine-1; small-inducible cytokine A26; macrophage inflammatory protein 4-alpha; small inducible cytokine subfamily A (Cys-Cys), member 26; TSC-1; MIP-4a; SCYA26; MIP-4alpha; MGC126714;
Gene ID 10344
mRNA Refseq NM_006072
Protein Refseq NP_006063
MIM 604697
UniProt ID Q9Y258

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CCL26 Products

Required fields are marked with *

My Review for All CCL26 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon